LABBench2-Pro: Complete Benchmark Examples (Chains 1–30)

A comprehensive set of 30 compositional reasoning chains for evaluating AI models on real-world biomedical research tasks. All data sourced from PDB, UniProt, ChEMBL, ClinVar, Open Targets, ClinicalTrials.gov, and published literature.

#	Chain	Template	Steps	Key Targets
1	SHP2 Allosteric Activation	Paper to Experiment	4	SHP2/PTPN11, PDB 2SHP
2	EGFR Kinase Inhibition	Structure to Drug	4	EGFR, PDB 1M17
3	TNBC Differential Expression	Stats Pipeline	3	BRCA1/2, RNA-seq
4	IDH1 Inhibitor in Glioma	Critical Appraisal	3	IDH1, PDB 3INM
5	PINK1 in Parkinsonism	Genetics to Therapy	3	PINK1 (Q9BXM7)
6	KRAS-BRAF Co-IP	Protocol Troubleshoot	3	KRAS (P01116), BRAF (PDB 1UWH)
7	ZEB1 KO Migration Paradox	Paradox Resolution	3	ZEB1, CDH1
8	Psychrophilic LDH	Sequence to Function	3	LDH, Shewanella benthica
9	GAPDH Cleavage Confound	Data to Mechanism	3	GAPDH, Caspase-3
10	ctDNA for Lung Cancer	Evidence Synthesis	3	cfDNA methylation, NSCLC
11	KRAS G12C / Sotorasib	Structure to Drug	4	KRAS (P01116), PDB 6OIM
12	JAK2 V617F in MPN	Paper to Experiment	4	JAK2 (O60674), PDB 4IVA
13	T2D GWAS Meta-analysis	Stats Pipeline	3	IFNAR2, T2D loci
14	Lecanemab in Alzheimer's	Critical Appraisal	3	APP, PSEN1, PDB 9CZI
15	CFTR F508del in CF	Genetics to Therapy	3	CFTR (P13569), PDB 5UAK
16	H3K27me3 ChIP-seq	Protocol Troubleshoot	3	EZH2, H3K27me3
17	PD-1 Hyperprogression	Paradox Resolution	3	PD-1/PD-L1, PDB 4ZQK
18	SARS-CoV-2 Mpro / Nirmatrelvir	Structure to Drug	4	Mpro, PDB 7SI9
19	Imatinib Resistance in CML	Data to Mechanism	3	BCR-ABL, PDB 1IEP
20	FLT3 Inhibitors in AML	Evidence Synthesis	3	FLT3 (P36888), PDB 6JQR
21	SCN1A in Dravet Syndrome	Genetics to Therapy	3	SCN1A (P35498), PDB 7DTD
22	CRISPR Base Editing in T Cells	Protocol Troubleshoot	3	ABE8e, CD4+ T cells
23	Novel AmpC β-Lactamase	Sequence to Function	3	AmpC, CMY-2
24	PCSK9 and LDL-R	Paper to Experiment	4	PCSK9 (Q8NBP7), PDB 2P4E
25	Exercise-Induced Immunosuppression	Paradox Resolution	3	CC16, Airway epithelium
26	Venetoclax + Azacitidine in AML	Data to Mechanism	3	BCL-2, MCL-1, DNMT3A
27	BRAF V600E in Melanoma	Evidence Synthesis	3	BRAF (P15056), PDB 3OG7
28	Novel CRISPR-Cas Effector	Sequence to Function	3	Cas12, TnpB
29	scRNA-seq of TILs	Stats Pipeline	3	CD8+ T cells, TCF7
30	Microbiome and Immunotherapy	Critical Appraisal	3	Gut microbiome, PD-1

Database Links Reference

Database	URL Pattern
PDB	`https://www.rcsb.org/structure/{ID}`
UniProt	`https://www.uniprot.org/uniprotkb/{ID}`
ChEMBL Compound	`https://www.ebi.ac.uk/chembl/compound_report_card/{ID}`
ClinicalTrials.gov	`https://clinicaltrials.gov/ct2/show/{NCT}`
Open Targets	`https://platform.opentargets.org/`
ClinVar	`https://www.ncbi.nlm.nih.gov/clinvar/`

Chain 1: Paper to Experiment (4 steps)

paper_to_experiment — SHP2 allosteric activation in RASopathy signaling

Step 1 — Extract key finding from literature

File: chain01_step1.json

Question: A 2021 study in Nature (LaRochelle et al.) found that the protein tyrosine phosphatase SHP2 (encoded by PTPN11; PDB: 2SHP) exists in an autoinhibited conformation where the N-SH2 domain occludes the catalytic PTP domain. Binding of bisphosphorylated peptides from receptors like PDGFR releases autoinhibition, increasing catalytic activity >50-fold. What is the structural mechanism of SHP2 autoinhibition, and why does the gain-of-function mutation E76K (found in juvenile myelomonocytic leukemia) bypass this regulation?
Ideal answer: In the autoinhibited state, the D'E loop of the N-SH2 domain inserts into the PTP active site, blocking substrate access. The E76 residue forms a salt bridge with K366 in the PTP domain that stabilizes this closed conformation. The E76K mutation eliminates this salt bridge and introduces charge repulsion (both now lysine), destabilizing the autoinhibited state and shifting the equilibrium toward the open, constitutively active form. This results in hyperactive RAS-MAPK signaling independent of upstream receptor activation.
Verification: llm-judge
Cascade risk: If the model misunderstands the autoinhibition mechanism, it cannot interpret dose-response data or design experiments correctly.

Step 2 — Quantitative data interpretation

File: chain01_step2.json

Question: Given that SHP2 autoinhibition is released by bisphosphorylated peptides, the following dose-response data shows SHP2 phosphatase activity (fold over basal) upon titration of a bisphosphorylated IRS-1 pY1172/pY1222 peptide: [peptide] = 0, 0.01, 0.1, 0.5, 1, 5, 10, 50 µM; fold-activity = 1.0, 1.2, 2.8, 8.5, 18, 42, 51, 54. The maximum activation plateau is ~54-fold. At what peptide concentration is half-maximal activation achieved? The cellular concentration of IRS-1 phosphopeptide during insulin stimulation is estimated at 0.5–2 µM. Is SHP2 activation likely to be switch-like or graded in cells?
Ideal answer: Half-maximal activation (~27-fold) occurs between 0.5 and 1 µM peptide, approximately 0.7 µM by interpolation. Since the estimated cellular concentration range (0.5–2 µM) spans the EC50, SHP2 activation in cells is graded, not switch-like — small changes in receptor signaling will produce proportional changes in SHP2 activity. This is consistent with SHP2 acting as a signal amplitude modulator rather than a binary switch. A Hill coefficient could be estimated from the data; the steep rise between 0.1–5 µM suggests moderate cooperativity (n_H ≈ 1.5–2).
Verification: llm-judge
Cascade risk: Wrong EC50 → wrong prediction about cellular regulation → wrong experimental design.

Step 3 — Statistical test selection

File: chain01_step3.json

Question: You want to test whether the E76K mutation shifts the EC50 for peptide-induced SHP2 activation compared to wild-type. You will measure phosphatase activity at 8 peptide concentrations (0–50 µM), 4 biological replicates per condition, for both WT and E76K SHP2. You expect E76K to have a lower EC50 (left-shifted curve) and possibly higher basal activity. What is the appropriate statistical framework to compare the dose-response curves and specifically test for EC50 differences?
Ideal answer: Fit four-parameter log-logistic dose-response models (bottom, top, EC50, Hill slope) to each dataset using nonlinear least-squares regression (e.g., drc package in R or scipy.optimize.curve_fit). Compare models using an extra-sum-of-squares F-test: fit a shared model (same EC50 for both) vs. separate models (different EC50s). The F-test p-value tells you whether allowing separate EC50s significantly improves the fit. Report EC50 ± 95% CI for each variant. Do not use t-tests on individual concentrations — this ignores the dose-response structure and inflates multiple comparisons. For the basal activity comparison specifically (0 µM), a Welch's t-test on the 4 replicates is appropriate.
Verification: llm-judge
Cascade risk: Using point-by-point t-tests instead of curve-fitting → miss the EC50 shift → wrong mechanistic conclusion.

Step 4 — Hypothesis generation

File: chain01_step4.json

Question: Based on your analysis — SHP2 autoinhibition is released by bisphosphorylated peptides with EC50 ~0.7 µM, activation is graded in the cellular concentration range, and E76K destabilizes the closed conformation — propose 3 testable hypotheses for why allosteric SHP2 inhibitors (e.g., SHP099, TNO155) show clinical efficacy in RAS-driven cancers but not in cancers with SHP2 E76K mutations (as observed in clinical trials NCT03114319).
Ideal answer: 1) Allosteric inhibitors stabilize the closed conformation that E76K already disrupts — the drug binding site (the interface between N-SH2 and PTP domains) is partially pre-opened in E76K, reducing inhibitor affinity by >10-fold. Testable: measure SHP099 Kd for WT vs. E76K by ITC or SPR. 2) E76K bypasses the activation step that allosteric inhibitors block — SHP099 prevents the conformational opening triggered by phosphopeptide binding, but E76K is constitutively open. Even complete allosteric inhibition cannot restore the autoinhibited state. Testable: measure SHP099 IC50 in phosphatase assay with E76K ± activating peptide; if peptide-independent, drug should fail regardless. 3) Catalytic site inhibitors should retain efficacy against E76K because the PTP active site is structurally intact. Testable: compare IC50 of allosteric (SHP099) vs. active-site inhibitor (e.g., IIB-08) against WT and E76K; predict active-site inhibitors show <3-fold shift while allosteric inhibitors show >10-fold.
Verification: llm-judge
Cascade risk: Terminal step — quality depends on correct understanding of mechanism, quantitative data, and statistical framework.

Data Provenance:

Data Type	Identifier	Details	Query Date
PDB	2SHP	SHP2 autoinhibited structure	2026-02-17
Gene	PTPN11	Encodes SHP2 protein tyrosine phosphatase	2026-02-17
Clinical Trial	NCT03114319	SHP2 inhibitor clinical trial (referenced in Step 4)	2026-02-17
Literature	LaRochelle et al. 2021	Nature, SHP2 autoinhibition mechanism	2026-02-17
Compound	SHP099	Allosteric SHP2 inhibitor	2026-02-17
Compound	TNO155	Allosteric SHP2 inhibitor	2026-02-17

Chain 2: Structure to Drug (4 steps)

structure_to_drug — EGFR kinase domain inhibition and resistance

Step 1 — Identify structural features

File: chain02_step1.json

Question: The crystal structure of the EGFR kinase domain bound to erlotinib (PDB: 1M17) was solved by X-ray diffraction. The EGFR kinase domain adopts an active conformation. How many protein chains are in the asymmetric unit? Identify the gatekeeper residue and the key residues forming the ATP-binding pocket that make direct contacts with erlotinib. Why is the gatekeeper residue clinically important?
Ideal answer: The asymmetric unit contains one protein chain (chain A). The gatekeeper residue is Thr790 (T790). Erlotinib binds in the ATP-binding cleft, forming: (1) a hydrogen bond from the quinazoline N1 to the backbone NH of Met793 in the hinge region, (2) the aniline ring extends toward the hydrophobic back pocket near Leu788 and Thr854, and (3) the ethynyl-phenyl group points toward solvent. The gatekeeper T790 is clinically critical because the T790M mutation introduces a bulkier methionine side chain that sterically clashes with erlotinib and increases ATP affinity ~5-fold, conferring resistance in ~60% of EGFR-mutant NSCLC patients who progress on first-generation TKIs. (Source: Open Targets EGFR-NSCLC association score = 0.885.)
Verification: llm-judge
Cascade risk: Wrong gatekeeper residue or wrong binding contacts → wrong resistance mechanism → wrong drug design.

Step 2 — Explain binding mechanism

File: chain02_step2.json

Question: Given the EGFR-erlotinib binding mode you described (hinge hydrogen bond to Met793, gatekeeper T790), explain how the third-generation inhibitor osimertinib overcomes T790M resistance. What is the key chemical difference between erlotinib and osimertinib that enables this? What new vulnerability does osimertinib's mechanism create?
Ideal answer: Osimertinib overcomes T790M through two mechanisms: (1) It is designed to accommodate methionine at position 790 — the pyrimidine core is smaller than erlotinib's quinazoline and the binding pose avoids steric clash with the bulkier M790 side chain. (2) It forms an irreversible covalent bond with Cys797 in the solvent-exposed region of the ATP site via a Michael acceptor acrylamide warhead. This covalent bond compensates for reduced non-covalent affinity against T790M. The vulnerability this creates: the C797S tertiary mutation eliminates the cysteine nucleophile required for covalent binding, ablating osimertinib's potency. C797S is the dominant mechanism of acquired resistance to osimertinib in ~10-15% of progressing patients. When C797S occurs in trans with T790M, the cancer remains sensitive to combination first + third-gen TKIs; in cis, neither works alone.
Verification: llm-judge
Cascade risk: Wrong binding mechanism → wrong SAR prediction.

Step 3 — SAR prediction

File: chain02_step3.json

Question: Given that osimertinib's efficacy depends on covalent bonding to Cys797 and C797S resistance eliminates this, a fourth-generation EGFR inhibitor must work without covalent Cys797 binding. Which design strategy would MOST likely yield a potent inhibitor of EGFR harboring L858R/T790M/C797S triple-mutant? A) Increase the reactivity of the acrylamide warhead to form a covalent bond with nearby Lys745 instead B) Design a reversible inhibitor with high shape complementarity to the mutant binding pocket, exploiting the unique conformation created by the triple mutation C) Add a PEG linker to extend the molecule into the allosteric pocket behind the αC-helix D) Replace the pyrimidine scaffold with a large macrocyclic peptide that binds outside the ATP pocket
Ideal answer: B. The triple mutant creates a unique active-site shape not found in wild-type EGFR, enabling selectivity. Allosteric approaches (C, D) lack precedent for sufficient potency against EGFR kinase. Redirecting covalent chemistry to Lys745 (A) is unreliable — lysine ε-amino is a poor nucleophile at physiological pH and would reduce selectivity across the kinome. The successful fourth-gen approach (exemplified by BLU-945, BLU-701) uses reversible binding with high shape complementarity to the triple-mutant pocket.
Verification: programmatic (multiple_choice: B)
Cascade risk: Wrong SAR reasoning → wrong validation design.

Step 4 — Experimental validation plan

File: chain02_step4.json

Question: Design a 4-step preclinical validation plan for your reversible fourth-generation EGFR inhibitor lead compound targeting L858R/T790M/C797S. Include: (1) biochemical potency, (2) cellular efficacy, (3) selectivity, and (4) in vivo proof of concept. Specify assays, cell lines, and key success criteria.
Ideal answer: (1) Biochemical: Caliper mobility-shift kinase assay measuring IC50 against recombinant EGFR L858R/T790M/C797S, plus WT and single/double mutant panel. Success: IC50 <10 nM against triple mutant, >100-fold selectivity over WT EGFR. (2) Cellular: Ba/F3 cells engineered with EGFR L858R/T790M/C797S (IL-3 independent growth), measure proliferation inhibition (CellTiter-Glo). Also test in patient-derived NSCLC cell lines with confirmed triple mutation (if available). Success: EC50 <100 nM, complete pathway suppression (pEGFR western). (3) Selectivity: KINOMEscan or similar panel against 468 kinases at 1 µM. Calculate selectivity score S(10). Key off-targets to monitor: ERBB2, ERBB4, BLK, BMX (kinases with Cys at gatekeeper+6 position). Success: S(10) <0.05. (4) In vivo: Ba/F3 EGFR triple-mutant subcutaneous xenograft in nude mice, BID oral dosing, 21-day study. Success: >60% tumor growth inhibition, no body weight loss >10%. Include osimertinib as negative control (expected inactive) and vehicle.
Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
PDB	1M17	EGFR kinase domain bound to erlotinib, active conformation	2026-02-17
Open Targets	EGFR-NSCLC	Association score: 0.885 (referenced in Step 1)	2026-02-17
Gene	EGFR	Gatekeeper residue T790, key residues Met793, Leu788, Thr854	2026-02-17
Compound	Erlotinib	First-generation EGFR TKI	2026-02-17
Compound	Osimertinib	Third-generation EGFR TKI, covalent bond to Cys797	2026-02-17
Compound	BLU-945, BLU-701	Fourth-generation reversible EGFR inhibitors (referenced)	2026-02-17

Chain 3: Stats Pipeline (3 steps)

stats_pipeline — Differential expression in triple-negative breast cancer

Step 1 — Choose statistical framework

File: chain03_step1.json

Question: You have RNA-seq data from 15 triple-negative breast cancer (TNBC) tumors and 15 matched adjacent normal tissues (same patient). Library prep: polyA-selected, 150bp PE, ~40M reads/sample. After alignment (STAR) and quantification (featureCounts), you have a raw count matrix of 22,487 genes × 30 samples. What statistical method should you use for differential expression analysis? Justify your choice, considering: (a) the data distribution, (b) the paired design, (c) potential confounders, and (d) why simpler approaches fail.
Ideal answer: Use DESeq2 (or equivalently edgeR) with a negative binomial generalized linear model including patient as a blocking factor. Justification: (a) RNA-seq counts follow an overdispersed Poisson → negative binomial distribution; variance is not proportional to mean, ruling out Poisson models. (b) The paired design (tumor vs. normal from same patient) must be modeled: design = ~ patient + condition — this controls for inter-individual variation and increases power. (c) Include batch if samples were sequenced in multiple runs; can model with surrogate variable analysis (svaseq) if hidden confounders suspected. (d) t-tests fail because they assume normality on continuous data and cannot handle count-specific mean-variance relationships. Log-transforming and running t-tests loses information at low counts and violates variance stabilization assumptions. Limma-voom is acceptable as an alternative (applies precision weights to log-CPM), especially with >15 samples where the normal approximation holds.
Verification: llm-judge
Cascade risk: Wrong method → wrong DE gene list → wrong pathway enrichment → wrong biological conclusion.

Step 2 — Multiple testing correction

File: chain03_step2.json

Question: Your DESeq2 analysis (paired model, n=15 per group) returns the following: 22,487 genes tested, 2,841 genes with raw p < 0.05, 1,573 genes with Benjamini-Hochberg adjusted p (FDR) < 0.05, 312 genes with FDR < 0.01. A collaborator suggests also running Bonferroni correction "to be safe." (a) How many genes would survive Bonferroni at α=0.05? (b) Is this appropriate for this experiment? (c) The collaborator also notes that 2,841/22,487 = 12.6% of genes are significant at p<0.05, far above 5% — is this evidence that something is wrong? (d) What is the expected number of false positives at FDR < 0.05?
Ideal answer: (a) Bonferroni threshold = 0.05/22,487 ≈ 2.2×10⁻⁶. Likely 50-150 genes would survive (roughly the most extreme subset). (b) Bonferroni is inappropriate here — it controls the family-wise error rate (probability of any false positive), which is overly conservative for genomics where we expect many true positives. BH-FDR is standard because it controls the proportion of false discoveries, trading a small false positive rate for much greater power. (c) 12.6% at nominal p<0.05 is expected and correct — it reflects a true biological signal. Under the null (no DE genes), you'd expect exactly 5%. The excess (12.6% − 5% = 7.6% × 22,487 ≈ 1,700 genes) is the estimated true positive signal. This is the basis of the BH procedure. (d) At FDR < 0.05 with 1,573 significant genes, the expected number of false positives ≤ 0.05 × 1,573 ≈ 79 genes. The remaining ~1,494 are expected true positives.
Verification: llm-judge
Cascade risk: Applying Bonferroni → losing >90% of real signal → missing key pathways.

Step 3 — Pathway interpretation

File: chain03_step3.json

Question: Gene ontology enrichment analysis (clusterProfiler, hypergeometric test, BH correction) on the 1,573 DE genes (FDR<0.05) returns these top results:

GO Term	P_adj	Gene Count	Fold Enrichment
Cell cycle (GO:0007049)	2.1×10⁻²⁸	127	3.8
DNA repair (GO:0006281)	8.4×10⁻¹⁶	68	3.2
Immune response (GO:0006955)	1.7×10⁻¹⁴	89	2.4
Extracellular matrix organization (GO:0030198)	3.2×10⁻⁶	31	2.1
Regulation of apoptosis (GO:0042981)	0.008	22	1.6
Ion transport (GO:0006811)	0.041	15	1.3

Your PI says: "Great, we have 6 pathways. Write them all up equally in the paper." What is wrong with this interpretation? Rank these results by biological relevance to TNBC and explain your reasoning.

Ideal answer: The PI's interpretation has three problems: (1) Not all results are equally significant. P-values span 22 orders of magnitude. Ion transport (p=0.041) is barely significant and would likely not survive a more stringent threshold or an independent replication. (2) Effect sizes differ dramatically. Cell cycle (3.8× enrichment, 127 genes) is far more robust than ion transport (1.3× enrichment, 15 genes). Small fold-enrichments are biologically ambiguous. (3) Biological coherence matters. For TNBC specifically:

Tier 1 — Core to TNBC biology:

Cell cycle: TNBC is defined by high proliferative index; this is the dominant signal and consistent with MKI67 overexpression.
DNA repair: TNBC is enriched for BRCA1/2 mutations (ClinVar lists >18,000 pathogenic BRCA2 variants) and homologous recombination deficiency — this is therapeutically actionable (PARP inhibitor sensitivity).

Tier 2 — Biologically relevant:

Immune response: TNBC has the highest tumor-infiltrating lymphocyte levels among breast subtypes; immune checkpoint inhibitors (pembrolizumab) now approved.
ECM organization: Consistent with TNBC's invasive phenotype.

Tier 3 — Weak/unclear:

Apoptosis regulation: Marginal enrichment (1.6×), could be secondary to proliferation signal.
Ion transport: Barely significant, low enrichment, no known role in TNBC. Likely noise; would drop from manuscript.

Report should weight by statistical significance × effect size × biological plausibility, not treat all as equal.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
Disease	Triple-Negative Breast Cancer	RNA-seq, 15 tumors + 15 matched normals	2026-02-17
ClinVar	BRCA2	>18,000 pathogenic variants (referenced in Step 3)	2026-02-17
GO Term	GO:0007049	Cell cycle (P_adj = 2.1×10⁻²⁸)	2026-02-17
GO Term	GO:0006281	DNA repair (P_adj = 8.4×10⁻¹⁶)	2026-02-17
GO Term	GO:0006955	Immune response (P_adj = 1.7×10⁻¹⁴)	2026-02-17
GO Term	GO:0030198	Extracellular matrix organization	2026-02-17
GO Term	GO:0042981	Regulation of apoptosis	2026-02-17
GO Term	GO:0006811	Ion transport	2026-02-17
Software	DESeq2, STAR, featureCounts, clusterProfiler	Analysis tools referenced	2026-02-17

Chain 4: Critical Appraisal (3 steps)

critical_appraisal — IDH1 inhibitor efficacy in glioma

Step 1 — Evaluate strength of evidence

File: chain04_step1.json

Question: A preprint on bioRxiv reports that a novel IDH1 R132H inhibitor ("compound X") reduces 2-hydroxyglutarate (2-HG) levels by 85% and shrinks tumors by 50% in a glioma mouse model. The study used: n=6 per group (vehicle vs. compound X), single cell line (U87 overexpressing IDH1-R132H), subcutaneous xenograft model, single dose level (50 mg/kg BID), 14-day study, p=0.03 for tumor volume. The crystal structure of IDH1-R132H is known (PDB: 3INM — resolution 2.1 Å, shows the mutant active site with NADPH and α-ketoglutarate). Is this sufficient evidence to conclude compound X is a promising IDH1 inhibitor for clinical development?
Ideal answer: No — this is preliminary evidence with multiple limitations:

Marginal statistics: p=0.03 with n=6 provides ~55% power for the stated effect size; the study was likely underpowered and the effect may be inflated.
Single cell line, artificial model: U87 cells overexpressing IDH1-R132H is an engineered system, not a naturally IDH1-mutant line. The endogenous mutation (heterozygous, with wild-type allele) behaves differently than an overexpression construct. Use patient-derived IDH1-mutant glioma lines (e.g., BT142, TS603).
Subcutaneous ≠ orthotopic: Gliomas grow in the brain behind the BBB. Subcutaneous models don't test brain penetration, which is critical for glioma drugs.
Single dose, no PK: No dose-response, no pharmacokinetic data showing brain exposure, no correlation between 2-HG reduction and tumor response.
No comparison to existing inhibitors: Ivosidenib (AG-120) is FDA-approved for IDH1-mutant cholangiocarcinoma. How does compound X compare?
Preprint, not peer-reviewed.

Verification: llm-judge
Cascade risk: Accepting weak evidence → wrong assessment when conflicting data arrives.

Step 2 — Integrate contradictory evidence

File: chain04_step2.json

Question: A follow-up peer-reviewed study (n=12 per group) tests compound X in three models:
BT142 (patient-derived, endogenous IDH1-R132H, orthotopic): 2-HG reduction 35%, tumor volume 12% reduction (p=0.31)
U87-IDH1R132H (subcutaneous, replication): 2-HG reduction 80%, tumor volume 38% reduction (p=0.01)
TS603 (patient-derived, endogenous IDH1-R132H, subcutaneous): 2-HG reduction 25%, tumor volume 8% increase (p=0.62)

Brain PK: compound X brain-to-plasma ratio = 0.05 (poor BBB penetration). How does this change your assessment from Step 1?

Ideal answer: This substantially weakens the case for compound X:

Original finding partially replicated in U87 model (38% vs. 50% reduction) but only in the artificial overexpression system.
Patient-derived lines show minimal effect: BT142 orthotopic (12%, NS) and TS603 (actually grew 8%). This pattern — large effect in overexpression, small in endogenous — suggests compound X potency depends on supraphysiological target expression.
2-HG reduction correlates with tumor response: 80% 2-HG reduction → tumor shrinkage; 25-35% → no response. The drug likely doesn't achieve sufficient target engagement in endogenous-expression contexts.
Brain penetration is a dealbreaker: Brain:plasma = 0.05 is far below the 0.3–0.5 threshold for CNS drugs. This explains the orthotopic failure — insufficient drug reaches the tumor.
Conclusion: Compound X is a moderately potent IDH1-R132H inhibitor in vitro but fails in vivo due to poor BBB penetration. Not suitable for glioma. May have utility in peripheral IDH1-mutant cancers (cholangiocarcinoma, AML) if re-evaluated, but ivosidenib (brain:plasma ~0.3) is already superior.

Verification: llm-judge
Cascade risk: Failure to identify BBB as key issue → inappropriate experimental recommendation.

Step 3 — Design definitive experiment

File: chain04_step3.json

Question: Based on your analysis — compound X has poor BBB penetration explaining orthotopic failure, moderate potency only at high target expression — design a definitive experiment that either rescues compound X for glioma or definitively kills the program. Specify: model, groups, sample sizes, endpoints, analysis plan, and decision criteria.
Ideal answer: Two-arm experiment testing whether the pharmacology problem is solvable:

Arm 1 — BBB bypass (proof-of-mechanism):

Model: BT142 orthotopic xenograft in nude mice
Groups (n=15 each): (a) Vehicle IP, (b) Compound X 50mg/kg BID oral, (c) Compound X 10mg/kg direct intracranial infusion via osmotic minipump (Alzet), (d) Ivosidenib 50mg/kg BID oral (positive control)
Endpoints: 2-HG in tumor (LC-MS/MS at sacrifice day 28), tumor volume (MRI days 0, 14, 28), survival
Decision criterion: If intracranial compound X (Arm c) reduces 2-HG >70% and tumor volume >30% but oral (Arm b) does not → pharmacology is valid, invest in BBB-penetrant analog. If intracranial also fails → target engagement insufficient even with adequate exposure → kill compound X.

Arm 2 — Peripheral IDH1 tumor (backup indication):

Model: ICC (intrahepatic cholangiocarcinoma) patient-derived xenograft with endogenous IDH1-R132H, subcutaneous
Groups (n=12): Vehicle, Compound X 25/50/100 mg/kg BID, Ivosidenib 150mg/kg QD
Endpoints: 2-HG, tumor volume, PK at each dose
Decision criterion: Compound X must achieve comparable 2-HG reduction and tumor response to ivosidenib at tolerable doses to justify further development.

Analysis: Two-way ANOVA with Dunnett's post-hoc (vs. vehicle). Pre-registered protocol. Pre-specify that the program stops if Arm 1c fails.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
PDB	3INM	IDH1-R132H mutant active site, resolution 2.1 Å	2026-02-17
Gene	IDH1	R132H mutation, 2-hydroxyglutarate (2-HG) production	2026-02-17
Cell Line	U87	Glioma cell line (overexpressing IDH1-R132H)	2026-02-17
Cell Line	BT142, TS603	Patient-derived IDH1-mutant glioma lines	2026-02-17
Compound	Ivosidenib (AG-120)	FDA-approved IDH1 inhibitor (comparator)	2026-02-17

Chain 5: Genetics to Therapy (3 steps)

genetics_to_therapy — PINK1 mutation in early-onset Parkinsonism

Step 1 — Gene function and disease mechanism

File: chain05_step1.json

Question: A consanguineous family presents with autosomal recessive early-onset Parkinsonism (onset age 28–32 in two siblings). Whole-exome sequencing reveals both affected siblings are homozygous for PINK1 c.926G>A (p.Gly309Asp). ClinVar lists 87 pathogenic PINK1 variants associated with young adult-onset Parkinsonism (Open Targets association score: 0.838). UniProt (Q9BXM7) annotates PINK1 as a serine/threonine kinase with the kinase domain spanning residues 156–511, active site at Asp362, and ATP-binding residues at 162–170 and 186. What is the normal function of PINK1 in mitochondrial quality control, and how would the Gly309Asp mutation within the kinase domain be expected to cause disease?
Ideal answer: PINK1 is a mitochondrial-targeted serine/threonine kinase that acts as a sensor of mitochondrial damage. Under normal conditions, PINK1 is imported into healthy mitochondria and rapidly degraded by PARL protease. When mitochondrial membrane potential collapses (ΔΨm loss), PINK1 import stalls, causing it to accumulate on the outer mitochondrial membrane (OMM). There, PINK1 autophosphorylates and then phosphorylates both ubiquitin (at Ser65) and the E3 ubiquitin ligase Parkin (at Ser65 of its Ubl domain), activating Parkin's ubiquitin ligase activity. Activated Parkin ubiquitinates OMM proteins (MFN1/2, VDAC, Miro), recruiting autophagy receptors (NDP52, OPTN) for mitophagy — the selective degradation of damaged mitochondria.

Gly309Asp impact: Gly309 is in the activation loop of the kinase domain (within the 156–511 kinase domain, near the DFG motif critical for kinase activation). Glycine's flexibility allows the activation loop to adopt the conformations needed for catalysis. Aspartate at this position introduces: (1) a bulky, charged side chain causing steric clash that rigidifies the activation loop, (2) disruption of the DFG motif positioning needed for Mg²⁺/ATP coordination, and (3) impaired autophosphorylation and substrate phosphorylation. Loss of PINK1 kinase activity → failure to activate Parkin → accumulation of damaged mitochondria → chronic oxidative stress → selective death of dopaminergic neurons in the substantia nigra (which have high metabolic demand and low antioxidant capacity).

Verification: llm-judge
Cascade risk: Wrong pathway → wrong structural analysis → wrong therapeutic targets.

Step 2 — Structural consequence of mutation

File: chain05_step2.json

Question: Gly309 is located in the activation loop of the PINK1 kinase domain. The activation loop in kinases must undergo a conformational change from the "DFG-out" (inactive) to "DFG-in" (active) state for catalysis. What specific structural consequences would you predict for the G309D mutation? How would you experimentally confirm the structural and functional impact? Propose 3 complementary experiments with expected results for both WT and G309D PINK1.
Ideal answer: Predicted structural consequences:
G309D introduces steric clash in the activation loop, preventing the DFG-in conformation needed for ATP positioning and substrate access
The aspartate's negative charge may create electrostatic repulsion with nearby acidic residues (Asp362 at the active site), destabilizing the catalytic architecture
The mutation likely reduces thermal stability of the kinase domain by introducing strain in a conformational hinge region

Three experiments:

Differential scanning fluorimetry (DSF/Thermal shift): Express and purify PINK1 kinase domain (residues 156–511) WT and G309D from insect cells. Measure Tm in presence/absence of ATP analog (AMP-PNP). Expected: WT Tm ~48°C, +4°C with AMP-PNP (ligand stabilization). G309D Tm ~42°C (destabilized), minimal shift with AMP-PNP (cannot bind ATP properly).
In vitro kinase assay: Measure phosphorylation of ubiquitin-Ser65 (the physiological substrate) using Phos-tag SDS-PAGE or anti-pSer65-Ub antibody. Expected: WT shows robust ubiquitin phosphorylation (Km_ATP ~50 µM); G309D shows <5% of WT activity, with dramatically increased Km_ATP (>500 µM) reflecting disrupted ATP binding.
Cellular mitophagy assay: Express WT or G309D PINK1 in PINK1-KO HeLa cells, treat with CCCP (10 µM, 2h) to depolarize mitochondria. Measure Parkin recruitment (GFP-Parkin translocation to mitochondria by confocal) and mitophagy (mt-Keima or mitoQC reporter). Expected: WT: >80% cells show Parkin translocation; G309D: <10%, similar to PINK1-KO. Mitophagy flux reduced >5-fold in G309D.

Verification: llm-judge
Cascade risk: Wrong structural model → wrong therapeutic strategy.

Step 3 — Therapeutic strategy

File: chain05_step3.json

Question: Given that PINK1-G309D causes loss of kinase activity, failure to phosphorylate ubiquitin/Parkin, and impaired mitophagy, propose two therapeutic strategies: one targeting the PINK1-Parkin pathway directly (upstream), and one targeting downstream consequences of mitophagy failure. For each, name specific compounds (existing or in development), explain their mechanism, and identify a key limitation.
Ideal answer:

Strategy 1 — Upstream: Bypass PINK1 with kinetin triphosphate (KTP) KTP is a neo-substrate that can be utilized by partially active PINK1 mutants with reduced catalytic efficiency. It is the triphosphate form of kinetin (N6-furfuryladenosine), a cytokinin that is converted intracellularly to KTP by adenosine kinase pathway. KTP has been shown to enhance residual PINK1 activity and restore Parkin activation in cells expressing hypomorphic PINK1 mutants. Kinetin itself is orally bioavailable and crosses the BBB. Key limitation: Requires residual PINK1 kinase activity — if G309D is truly catalytically dead (rather than reduced), KTP cannot help. Must empirically test whether G309D retains any measurable activity that KTP can amplify. If not, this strategy fails for this specific mutation.

Strategy 2 — Downstream: Mitochondria-targeted antioxidant MitoQ or elamipretide (SS-31/Bendavia) MitoQ (mitoquinone) is a ubiquinone derivative conjugated to a triphenylphosphonium cation that accumulates ~500-fold in mitochondria driven by membrane potential. It scavenges reactive oxygen species at the inner mitochondrial membrane, directly addressing the oxidative stress caused by accumulated damaged mitochondria. SS-31 (elamipretide) targets cardiolipin in the inner mitochondrial membrane, stabilizing electron transport chain complexes and reducing electron leak/ROS production. SS-31 has reached Phase III trials for mitochondrial myopathy (NCT03323749). Key limitation: These address symptoms (ROS damage) not cause (mitophagy failure). Damaged mitochondria still accumulate, with potential for mitochondrial DNA mutations, impaired calcium buffering, and bioenergetic failure. Long-term efficacy uncertain — may slow progression but not halt it. Also does not address non-oxidative consequences of mitophagy failure (e.g., inflammation from mtDNA release activating cGAS-STING).

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
UniProt	Q9BXM7	PINK1, kinase domain 156–511, active site Asp362, ATP-binding 162–170/186	2026-02-17
ClinVar	PINK1	87 pathogenic variants, young adult-onset Parkinsonism	2026-02-17
Open Targets	PINK1-Parkinsonism	Association score: 0.838	2026-02-17
Variant	c.926G>A (p.Gly309Asp)	Homozygous, in activation loop of kinase domain	2026-02-17
Compound	Kinetin (KTP)	Neo-substrate enhancing residual PINK1 activity	2026-02-17
Compound	MitoQ	Mitochondria-targeted antioxidant	2026-02-17
Clinical Trial	NCT03323749	SS-31 (elamipretide) Phase III, mitochondrial myopathy	2026-02-17

Chain 6: Protocol Troubleshoot (3 steps)

protocol_troubleshoot — Co-immunoprecipitation of KRAS-BRAF interaction

Step 1 — Diagnose protocol error

File: chain06_step1.json

Question: You are studying the KRAS-BRAF interaction in HEK293T cells overexpressing FLAG-KRAS-G12V and HA-BRAF (PDB: 1UWH shows wild-type BRAF structure). Your co-immunoprecipitation protocol: lyse in NP-40 buffer (50mM Tris pH 7.4, 150mM NaCl, 1% NP-40, protease inhibitors), immunoprecipitate with anti-FLAG M2 beads 2h at 4°C, wash 3× with lysis buffer, elute with 2× Laemmli sample buffer, western blot with anti-HA. Result: Strong FLAG-KRAS band in IP input and IP lanes (anti-FLAG blot). But anti-HA western shows strong BRAF band in input but NO band in the IP lane. Positive control (cells expressing FLAG-BRAF alone, IP with anti-FLAG) works fine. What is the most likely reason for failing to co-IP BRAF with KRAS?
Ideal answer: The most likely issue is that KRAS-BRAF interaction requires GTP loading, and you are not preserving the active GTP-bound state during lysis. Although KRAS-G12V is constitutively active (impaired GTPase activity), the 2-hour incubation at 4°C in lysis buffer allows residual GTPase activity and does not include GTPγS to lock KRAS in the active conformation. More critically: 1% NP-40 is too harsh for this transient signaling complex. The KRAS-BRAF interaction involves the KRAS effector domain (residues 29-40; UniProt P01116 Switch I region at 29-35) binding the BRAF RAS-binding domain, which is a relatively low-affinity interaction (Kd ~0.1-1 µM). 1% NP-40 disrupts this weak interaction during the extended IP. Fix: (1) Switch to milder detergent: 0.5% Triton X-100 or 0.1% NP-40, (2) add 100 µM GTPγS and 5mM MgCl₂ to lysis buffer to lock KRAS-GTP, (3) shorten IP to 30–45 minutes, (4) add phosphatase inhibitors (the interaction is partly stabilized by BRAF phosphorylation).
Verification: llm-judge
Cascade risk: Wrong diagnosis → wrong fix → continued failure.

Step 2 — Interpret corrected result

File: chain06_step2.json

Question: After switching to 0.1% NP-40, adding GTPγS/MgCl₂, and reducing IP time to 45 min, you now see: anti-HA blot of FLAG IP shows a strong band at ~87 kDa and a weaker band at ~95 kDa. BRAF's predicted molecular weight is 84.4 kDa. Are these bands consistent with BRAF? What explains the two bands and their different intensities? What additional control would confirm these are specifically BRAF?
Ideal answer: The 87 kDa band is consistent with BRAF (predicted 84.4 kDa; proteins typically run slightly above predicted MW on SDS-PAGE due to post-translational modifications and SDS binding variability). The 95 kDa band is likely phosphorylated BRAF — activation loop phosphorylation (at S446, S447, D448, and the critical T599/S602 phosphosites) causes a mobility shift of ~8-10 kDa on standard SDS-PAGE gels, which is a well-documented phenomenon for RAF kinases. The weaker intensity of the 95 kDa band indicates that only a fraction of co-IPed BRAF is in the fully phosphorylated/activated state, consistent with the signaling cascade (KRAS-GTP recruits BRAF, but activation requires additional events including dimerization and phosphorylation).

Controls to confirm identity: (1) Treat the IP sample with lambda phosphatase — the 95 kDa band should collapse into the 87 kDa band. (2) Blot with anti-pBRAF-S445 antibody — should label only the upper band. (3) Perform IP from cells expressing FLAG-KRAS-G12V without HA-BRAF — neither band should appear (rules out non-specific HA antibody cross-reactivity).

Verification: llm-judge
Cascade risk: Wrong band assignment → wrong interpretation of interaction dynamics.

Step 3 — Quantitative follow-up

File: chain06_step3.json

Question: You want to quantify how different KRAS mutations affect BRAF binding efficiency. You will express FLAG-KRAS (WT, G12V, G12C, G12D, G13D, Q61H) with HA-BRAF, perform co-IP under your optimized conditions, and compare the amount of BRAF co-immunoprecipitated. Describe the quantification strategy: normalization, controls, number of replicates, and the correct statistical test. How would you present this data?
Ideal answer: Quantification: Densitometry of anti-HA (BRAF) and anti-FLAG (KRAS) bands using ImageJ/ImageStudio. Calculate binding efficiency ratio = (HA-BRAF band intensity in IP) / (FLAG-KRAS band intensity in IP) for each mutant. This normalizes for IP efficiency differences.

Essential controls: (1) Input blots for both FLAG-KRAS and HA-BRAF to confirm equal expression across conditions. (2) Empty vector FLAG-IP (background subtraction). (3) FLAG-KRAS-S17N (dominant-negative, GDP-locked) as negative control — should show minimal BRAF binding.

Replicates: Minimum 4 biological replicates (independent transfections on different days). All 6 mutants + WT + S17N run on the same blot per replicate to minimize blot-to-blot variability.

Statistical test: One-way ANOVA with Dunnett's post-hoc test comparing each mutant to WT-KRAS. Check normality (Shapiro-Wilk) and homoscedasticity (Levene's test) on the ratio data; if violated, use Kruskal-Wallis with Dunn's post-hoc. With 8 groups and 4 replicates, report effect sizes (fold-change vs. WT) alongside p-values.

Presentation: Bar graph showing mean binding efficiency ratio ± SEM for each KRAS variant, ordered by binding strength. Include individual data points overlaid (n=4 is too few for box plots). Include a representative western blot panel below the quantification graph. Report: "G12V showed 4.2±0.6-fold enrichment of BRAF compared to WT (p=0.003, Dunnett's test)."

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
PDB	1UWH	Wild-type BRAF structure	2026-02-17
UniProt	P01116	KRAS, 189 aa, Switch I region residues 29–35, effector domain 29–40	2026-02-17
Gene	KRAS	Mutations: G12V, G12C, G12D, G13D, Q61H, S17N (dominant-negative)	2026-02-17
Gene	BRAF	Predicted MW 84.4 kDa, phosphosites S446/S447/T599/S602	2026-02-17

Chain 7: Paradox Resolution (3 steps)

paradox_resolution — CRISPR KO of ZEB1 paradoxically increases migration

Step 1 — Explain paradoxical result

File: chain07_step1.json

Question: ZEB1 is a well-established promoter of epithelial-mesenchymal transition (EMT): it represses E-cadherin (CDH1) and drives mesenchymal gene expression. You perform CRISPR knockout of ZEB1 in A549 lung adenocarcinoma cells (confirmed by western blot — no detectable ZEB1 protein). Scratch wound-healing assay shows ZEB1-KO cells close the wound 2.1× faster than WT (p<0.001, n=6). This contradicts the expectation that losing an EMT driver should reduce migration. Propose at least 3 mechanistic hypotheses to explain this paradox, ranking them by plausibility.
Ideal answer: Hypothesis 1 (Most plausible): Collective vs. individual migration switch. ZEB1-KO restores E-cadherin, converting cells from mesenchymal (individual, slow but invasive) to epithelial (collective, fast sheet migration). Wound-healing assays measure 2D collective migration, which is enhanced by cell-cell adhesion via E-cadherin-mediated coordination. The ZEB1-KO cells move faster as a sheet but may have lost the ability to invade through matrix as individuals. This is a known phenomenon: epithelial collectives can migrate faster than mesenchymal single cells in 2D.

Hypothesis 2 (Plausible): ZEB2 paralog compensation. A549 cells express both ZEB1 and ZEB2. ZEB1 knockout may relieve a negative regulatory feedback on ZEB2, causing ZEB2 upregulation. ZEB2 can promote a hybrid EMT state that paradoxically enhances motility. Additionally, ZEB1 and ZEB2 have non-redundant target gene profiles — ZEB2 may activate distinct pro-migratory programs (e.g., MMP expression) not activated by ZEB1.

Hypothesis 3 (Possible): Proliferation confound. The wound-healing assay doesn't distinguish migration from proliferation. If ZEB1-KO increases proliferation rate (ZEB1 has antiproliferative functions via p21/CDKN1A derepression paradoxically — but actually ZEB1 represses senescence), faster wound closure could reflect faster gap-filling by division, not migration per se.

Hypothesis 4 (Less likely): Rho GTPase rewiring. Loss of ZEB1 may alter the Rac1/RhoA balance. Mesenchymal cells use RhoA-driven contractile migration; epithelial cells use Rac1-driven lamellipodia. Rac1-dependent migration is faster in unconfined 2D environments.

Verification: llm-judge
Cascade risk: Can't generate good hypotheses → can't design discriminating experiments.

Step 2 — Design discriminating experiment

File: chain07_step2.json

Question: Your top two hypotheses are: (H1) collective migration — ZEB1-KO cells migrate faster as a sheet but are less invasive individually, and (H2) ZEB2 compensation — ZEB2 upregulation drives a hybrid EMT state with enhanced motility. Design ONE experiment that cleanly distinguishes H1 from H2. Specify: assay, cell lines/conditions, controls, readouts, and the expected result pattern for each hypothesis.
Ideal answer: Experiment: 3D Matrigel Transwell invasion assay with ZEB2 perturbation

Cell lines/conditions (all in parallel):

A549 WT (parental)
A549 ZEB1-KO
A549 ZEB1/ZEB2 double-KO
A549 ZEB1-KO + siZEB2 (transient, to confirm genetic KO result)

Assay: 8 µm pore Transwell inserts coated with 1 mg/mL Matrigel. Plate 5×10⁴ cells in serum-free media in upper chamber, 10% FBS in lower chamber as chemoattractant. 24h incubation. Fix, stain (crystal violet), count invaded cells per field (10 fields). n=4 biological replicates.

Additional readouts: (a) Western blot for ZEB2, E-cadherin, vimentin, N-cadherin in all conditions. (b) Parallel wound-healing assay on same cells for direct comparison.

Expected results if H1 (collective migration) is correct:

Wound healing: ZEB1-KO > WT (as observed). Double-KO similar or even faster (more epithelial).
Matrigel invasion: ZEB1-KO < WT (reduced invasion despite faster wound closure). Double-KO even lower.
Markers: ZEB1-KO shows E-cadherin UP, vimentin DOWN. ZEB2 levels unchanged or modest increase.

Expected results if H2 (ZEB2 compensation) is correct:

Wound healing: ZEB1-KO > WT (as observed). Double-KO < WT (reverts phenotype).
Matrigel invasion: ZEB1-KO ≥ WT (maintained or increased). Double-KO << WT (collapses).
Markers: ZEB1-KO shows ZEB2 strongly UP (>3-fold), partial E-cadherin restoration, vimentin maintained.

Key discriminator: The Matrigel invasion result for ZEB1-KO is decisive. H1 predicts invasion goes DOWN (migration ≠ invasion). H2 predicts invasion stays UP or increases (ZEB2 drives both).

Verification: llm-judge
Cascade risk: Bad experiment → can't resolve paradox.

Step 3 — Synthesize conclusion from results

File: chain07_step3.json

Question: Results from your experiment:

Condition	Wound closure (% of WT)	Matrigel invasion (% of WT)	E-cadherin	Vimentin	ZEB2
WT	100%	100%	Low	High	Moderate
ZEB1-KO	210%	38% (p<0.01)	High	Low	1.3× (NS)
Double-KO	190%	15% (p<0.001)	High	Very low	N/A

Which hypothesis is supported? What does this mean for the interpretation of wound-healing assays in EMT research? What would you recommend to the field?

Ideal answer: H1 (collective migration) is strongly supported:
ZEB1-KO cells are 2.1× faster in wound healing but only 38% as invasive through Matrigel — a clear dissociation between 2D migration and 3D invasion.
ZEB2 is NOT significantly upregulated (1.3×, NS), ruling out H2. The double-KO further reduces invasion (15%) without reducing wound closure speed (190%), confirming that the epithelial phenotype drives fast sheet migration but not matrix invasion.
Marker pattern is cleanly epithelial: E-cadherin restored, vimentin reduced. This is a collective epithelial migration phenotype.

Implications for EMT research:

Wound-healing/scratch assays are misleading for EMT studies. They measure 2D collective migration, which is enhanced by epithelial cell-cell adhesion, creating the paradox where EMT reversal appears to increase "migration."
The field should use 3D invasion assays (Matrigel Transwell, spheroid invasion, collagen gel invasion) as the primary readout for EMT-driven motility. Wound-healing assays should be clearly labeled as measuring "collective migration" not "invasive potential."
EMT is not a single program. Cells can be highly migratory (epithelial sheet migration) without being invasive (mesenchymal single-cell invasion). This distinction has clinical implications: metastatic potential correlates with invasion, not 2D migration speed.
Recommendation: Papers studying EMT effects on motility should include both wound-healing AND Transwell invasion. Reports of "increased migration" upon MET (mesenchymal-to-epithelial transition) likely reflect this collective migration artifact.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
Gene	ZEB1	EMT transcription factor, represses CDH1 (E-cadherin)	2026-02-17
Gene	ZEB2	Paralog of ZEB1, non-redundant target profiles	2026-02-17
Cell Line	A549	Lung adenocarcinoma, CRISPR ZEB1 knockout	2026-02-17
Assay	Wound-healing	ZEB1-KO: 2.1× faster closure (p<0.001, n=6)	2026-02-17
Assay	Matrigel Transwell	ZEB1-KO: 38% of WT invasion (p<0.01)	2026-02-17

Chain 8: Sequence to Function (3 steps)

sequence_to_function — Psychrophilic lactate dehydrogenase from a deep-sea organism

Step 1 — Identify protein from sequence

File: chain08_step1.json

Question: A protein was identified from metagenomic sequencing of a hydrothermal vent-adjacent cold seep organism (Shewanella benthica at 4°C, 500 atm, Mariana Trench). The first 120 residues of the protein are:

MATLKDQLIVNVWQEVDKFGHNITQSSGSILTAFNPETIKIFYAGSSEVDQGKIFADLNRHIGKEPLKIYIAGDNQDKAIAQETADFIRSDLALQTEYVDKLFPIVKEKYGENFDEKFKD

What protein family does this belong to? Identify the key conserved motifs and catalytic residues you would expect based on the sequence.

Ideal answer: This sequence belongs to the L-lactate dehydrogenase (LDH) family (EC 1.1.1.27). Key identifiers:

Rossmann fold NAD⁺-binding motif: The "GxGxxG" variant is present in the N-terminal region (~residues 28-33), characteristic of NAD⁺/NADH-dependent oxidoreductases.
Catalytic residues: Based on LDH family conservation: His193 (proton shuttle in catalysis), Arg169 (substrate carboxylate binding), and Asp166 (positions the catalytic His). These are numbered based on alignment to canonical LDH.
Substrate specificity loop: Residues ~95-110 determine L-lactate vs. L-malate specificity. The presence of Gln at the key position suggests lactate preference (glutamine→arginine switch converts LDH to MDH).
Mobile loop: Residues ~95-107 form the "active site loop" that closes over the substrate during catalysis.

The protein would be expected to form a homotetramer (typical quaternary structure for bacterial LDH), with each subunit ~35 kDa.

Verification: llm-judge
Cascade risk: Wrong family → wrong functional predictions → wrong experiment design.

Step 2 — Predict functional consequences of sequence differences

File: chain08_step2.json

Question: Compared to mesophilic Lactobacillus LDH (optimal activity at 37°C), this deep-sea Shewanella LDH has three notable substitutions in the active site vicinity: (1) Pro135→Gly (in a loop near the active site), (2) Ile250→Val (in the hydrophobic core near the subunit interface), (3) Ala→Ser at position 222 (on the surface near the active site entrance). The organism lives at 4°C and 500 atm pressure. How might each substitution represent a cold adaptation, pressure adaptation, or both? Use principles of psychrophilic enzyme biochemistry to explain.
Ideal answer: (1) Pro135→Gly: Cold adaptation. Proline restricts backbone flexibility (locked φ angle). Replacing it with glycine (maximal backbone freedom) increases local flexibility in the loop near the active site. Psychrophilic enzymes systematically replace Pro with Gly/Ala in regions requiring conformational change during catalysis, enabling the protein to maintain sufficient dynamics at low temperatures where thermal energy is limited. This is one of the most well-documented cold adaptation strategies.

(2) Ile250→Val: Primarily cold adaptation, possibly pressure-relevant. Both are hydrophobic and branched, but valine is smaller (one fewer CH₂). In the hydrophobic core near the subunit interface, this creates slightly looser packing, reducing van der Waals stabilization. This lowers the energy barrier for conformational fluctuations at 4°C. However, reduced core volume is counterproductive under pressure (pressure favors smaller total volume). This mutation may represent a trade-off — the cold-adaptation benefit outweighs the pressure cost, or other substitutions compensate.

(3) Ala222→Ser: Pressure adaptation. Adding a hydroxyl group on the surface near the active site entrance increases hydration — water molecules form hydrogen bonds with Ser that are more compressible than the cavity that would exist with Ala. Under high pressure, water-filled hydrogen bond networks have smaller molar volume than hydrophobic surfaces with excluded-volume cavities. Surface polar substitutions are a hallmark of piezophilic (pressure-adapted) enzymes. This also slightly increases the solvent-accessible surface area, facilitating pressure-resistant solvation.

Summary: The organism faces two competing challenges — cold demands flexibility, pressure demands reduced compressible volume. Substitutions 1 and 2 primarily serve cold adaptation (increased flexibility), while substitution 3 serves pressure adaptation (improved hydration). This mixed strategy is typical of psychropiezophilic enzymes.

Verification: llm-judge
Cascade risk: Wrong adaptation reasoning → wrong biochemical predictions → wrong experimental expectations.

Step 3 — Design validation experiment

File: chain08_step3.json

Question: Design a comprehensive experiment to test whether the three substitutions (P135G, I250V, A222S) confer cold and/or pressure tolerance to this LDH. You must compare the deep-sea Shewanella LDH to the mesophilic Lactobacillus LDH, and also test individual point mutations to deconvolve contributions. Describe: protein expression, purification, activity measurements, and key predictions with quantitative expectations.
Ideal answer: Expression & Purification:
Clone both LDH genes (codon-optimized for E. coli) plus 6 point mutants into pET28a with N-terminal His₆ tag:
- Shewanella WT (cold-adapted)
- Lactobacillus WT (mesophilic)
- Lactobacillus G135P, V250I, S222A (revert each cold mutation individually)
- Shewanella P135G→revert, etc. (introduce mesophilic residues into cold-adapted)
Express in E. coli BL21(DE3) at 16°C (for solubility of cold-adapted variants)
Purify: Ni-NTA affinity → size exclusion (Superdex 200, confirm tetramer)

Activity measurements — Temperature profile:

Kinetics (pyruvate → lactate, monitor NADH consumption at A340) at 4, 10, 15, 20, 25, 30, 37, 45°C
Measure kcat, Km(pyruvate), Km(NADH), catalytic efficiency (kcat/Km) at each temperature
Prediction: Shewanella LDH: kcat/Km peaks at 10-15°C, retains >50% activity at 4°C vs. 37°C optimum. Lactobacillus: peaks at 37°C, <10% activity at 4°C.

Activity measurements — Pressure profile (requires high-pressure equipment):

Fluorescence-based kinetic assay in a diamond anvil cell or high-pressure optical cell
Measure activity at 1, 100, 250, 500, 750 atm at two temperatures (4°C and 25°C)
Prediction: Shewanella: <20% activity loss at 500 atm. Lactobacillus: >60% loss at 500 atm.

Stability measurements:

DSF (differential scanning fluorimetry): measure Tm for all variants at 1 atm
Prediction: Shewanella Tm ~40°C (lower than Lactobacillus ~55°C), reflecting flexibility-stability trade-off

Deconvolution by point mutants:

P135G single reversion in Lactobacillus: predict ~2-fold improvement at 4°C (flexibility)
A222S single mutation in Lactobacillus: predict minimal cold effect but improved activity at 250+ atm
I250V in Lactobacillus: predict modest cold improvement, slight pressure sensitivity

This separates the contributions of each residue to cold vs. pressure adaptation.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
Organism	Shewanella benthica	Deep-sea cold seep, 4°C, 500 atm, Mariana Trench	2026-02-17
Protein Family	L-lactate dehydrogenase	EC 1.1.1.27, Rossmann fold, homotetramer ~35 kDa/subunit	2026-02-17
Substitutions	P135G, I250V, A222S	Cold/pressure adaptation mutations vs. mesophilic Lactobacillus LDH	2026-02-17
Catalytic Residues	His193, Arg169, Asp166	Based on LDH family conservation (canonical numbering)	2026-02-17

Chain 9: Data to Mechanism (3 steps)

data_to_mechanism — Unexpected GAPDH cleavage during apoptosis confounds western blot quantification

Step 1 — Interpret ambiguous data

File: chain09_step1.json

Question: You are studying the effect of staurosporine (1 µM, 6h) on AKT phosphorylation in Jurkat T-cells. Your western blot for the loading control GAPDH (expected MW: 36 kDa) shows:
Lane 1 (DMSO vehicle): Single strong band at ~37 kDa
Lane 2 (Staurosporine 1 µM): Strong band at ~37 kDa + unexpected additional band at ~25 kDa (~30% intensity of full-length)
Lane 3 (Media-only control): Single strong band at ~37 kDa

The anti-GAPDH antibody is monoclonal (clone 6C5, epitope in N-terminal domain). List at least 3 possible explanations for the 25 kDa band in lane 2, ranked by likelihood. What single additional experiment would most efficiently distinguish between them?

Ideal answer: Ranked explanations:

(Most likely) Caspase-mediated GAPDH cleavage. Staurosporine is a potent inducer of apoptosis in Jurkat cells (activates caspase-3/7 within 2-4h). GAPDH is a known caspase-3 substrate, cleaved at Asp238, producing an N-terminal fragment of ~25 kDa and a C-terminal fragment of ~11 kDa. Since the antibody (clone 6C5) recognizes the N-terminal domain, it detects both full-length (37 kDa) and the N-terminal cleavage fragment (25 kDa). The ~30% cleavage is consistent with partial apoptosis at 6h.
(Possible) Non-specific cross-reactivity. The 25 kDa band could be a staurosporine-induced protein that cross-reacts with the antibody. However, monoclonal clone 6C5 is highly specific and widely validated, making this unlikely. Also, the band would need to be staurosporine-inducible, which is a coincidence.
(Less likely) Alternative translation/splicing. An alternative GAPDH transcript could produce a smaller isoform. However, this would be present in all lanes, not only staurosporine-treated.
(Unlikely) Degradation artifact. Sample degradation during lysis. However, all lanes were processed identically and only lane 2 shows the extra band.

Distinguishing experiment: Add Z-VAD-FMK (pan-caspase inhibitor, 50 µM, 1h pre-treatment) before staurosporine. If the 25 kDa band is caspase-mediated cleavage, Z-VAD-FMK will abolish it. If it's non-specific or an isoform, Z-VAD-FMK will have no effect. This single experiment distinguishes hypothesis 1 from all others.

Verification: llm-judge
Cascade risk: Wrong interpretation → wrong mechanistic model → wrong quantification correction.

Step 2 — Update with new evidence

File: chain09_step2.json

Question: You performed the Z-VAD-FMK experiment and two additional controls:
Staurosporine alone: 25 kDa band present (as before)
Z-VAD-FMK + staurosporine: 25 kDa band completely absent
Annexin V/PI flow cytometry of staurosporine-treated cells: 52% Annexin V+ (early + late apoptotic)
Caspase-3/7 activity (Caspase-Glo): 12-fold increase over vehicle

These results confirm caspase-mediated GAPDH cleavage. Now: (a) What does this mean for using GAPDH as a loading control in this experiment? (b) What alternative loading controls would be valid? (c) For the 48% of cells that are NOT apoptotic (Annexin V−), is the GAPDH in those cells intact?

Ideal answer: (a) GAPDH is INVALID as a loading control here. The 25 kDa cleavage product means that total intact GAPDH is reduced in the staurosporine lane — densitometry of the 37 kDa band underestimates total protein, and summing 37+25 kDa bands is unreliable (transfer efficiency may differ for different-sized fragments). Any protein normalized to GAPDH will appear artificially increased in the staurosporine lane because the denominator is artifactually low.

(b) Valid alternatives:

Total protein staining (Ponceau S or Stain-Free): Measures all proteins in each lane, independent of any single protein's behavior. Best option for apoptosis experiments.
Na⁺/K⁺-ATPase (ATP1A1): Membrane protein, not a caspase substrate, MW ~113 kDa.
Total histone H3: Nuclear protein, not cleaved by caspase-3 (though histone H2B can be). ~15 kDa.
Vinculin (~124 kDa): Large cytoskeletal protein, not reported as caspase substrate. Avoid: β-actin (caspase-3 substrate), β-tubulin (caspase-6 substrate), lamin A/C (caspase-6 substrate). These are all cleaved during apoptosis and share the same confound.

(c) In the viable 48%, GAPDH is likely intact — caspase-3 is only activated in apoptotic cells. However, western blots from whole lysates represent the mixed population. The 37 kDa band is a mixture of GAPDH from viable and apoptotic cells; the 25 kDa band comes only from apoptotic cells. You cannot deconvolve these at the western blot level — you would need to sort Annexin V− cells before lysis to analyze only the viable population.

Verification: llm-judge
Cascade risk: Wrong loading control → all quantification invalid.

Step 3 — Correct prior analysis

File: chain09_step3.json

Question: Your original analysis (before discovering the GAPDH problem) reported: "Staurosporine reduced phospho-AKT(S473) by 75% compared to vehicle (normalized to GAPDH)." Given that GAPDH is ~30% cleaved in the staurosporine lane (meaning intact GAPDH is reduced to ~70% of its true total), answer: (a) Is the 75% reduction in pAKT real, overestimated, or underestimated? Show the math. (b) What is the likely true reduction if you correct for the GAPDH artifact? (c) You need to re-analyze the experiment properly. Describe exactly how you would re-probe the membrane and recalculate.
Ideal answer: (a) The 75% reduction is OVERESTIMATED. Here's the math:

The reported ratio = (pAKT_stau / GAPDH_stau) / (pAKT_veh / GAPDH_veh) = 0.25 (i.e., 75% reduction).

But GAPDH_stau is only 70% of what it should be (30% cleaved). So the true ratio should use corrected GAPDH:

Let's call the true pAKT ratio = R. Reported: pAKT_stau / (0.70 × GAPDH_true) = 0.25 × (pAKT_veh / GAPDH_veh) Corrected: pAKT_stau / GAPDH_true = 0.25 × 0.70 × (pAKT_veh / GAPDH_veh) = 0.175

Wait — let me reconsider. The normalization divides by GAPDH. If GAPDH appears lower (70% of true), then pAKT/GAPDH is inflated in the staurosporine lane, meaning the drug's effect appears smaller than reality...

Actually: Revised analysis. Normalized pAKT = (pAKT band) / (GAPDH band). If GAPDH band is artifactually low (70% of true), then normalized pAKT = (pAKT) / (0.7 × true GAPDH) = (1/0.7) × (pAKT/true GAPDH) = 1.43× overestimate of the ratio. So the staurosporine lane's pAKT appears 1.43× higher relative to vehicle than it truly is.

Reported pAKT_stau / pAKT_veh (normalized) = 0.25. Corrected = 0.25 × 0.70 = 0.175, meaning true reduction is ~82.5%, not 75%.

(b) The true pAKT reduction is ~82-83%. The GAPDH artifact made the drug appear less effective than it actually is (denominator too small → ratio too high → drug effect appears smaller).

(c) Re-analysis procedure:

Strip the membrane (Restore stripping buffer, 15 min, RT)
Re-probe with Ponceau S total protein stain (photograph before blocking) OR anti-vinculin antibody as validated loading control
Quantify: pAKT(S473) band intensity / Ponceau total lane intensity (or vinculin band) for each lane
Calculate fold-change: (corrected ratio staurosporine) / (corrected ratio vehicle)
Report the corrected values and explicitly note the GAPDH artifact in the methods: "GAPDH was initially used as loading control but showed caspase-3-dependent cleavage in staurosporine-treated samples; data were re-normalized to total protein (Ponceau S)."

Verification: llm-judge
Cascade risk: Terminal step — tests backward error correction and quantitative reasoning.

Data Provenance:

Data Type	Identifier	Details	Query Date
Protein	GAPDH	36 kDa, caspase-3 substrate, cleavage at Asp238	2026-02-17
Antibody	Clone 6C5	Monoclonal anti-GAPDH, N-terminal epitope	2026-02-17
Cell Line	Jurkat	T-cell line, staurosporine 1 µM / 6h → 52% Annexin V+	2026-02-17
Compound	Staurosporine	Apoptosis inducer, caspase-3/7 activator	2026-02-17
Compound	Z-VAD-FMK	Pan-caspase inhibitor (50 µM), abolishes GAPDH cleavage	2026-02-17

Chain 10: Evidence Synthesis (3 steps)

evidence_synthesis — Circulating tumor DNA (ctDNA) for early lung cancer detection

Step 1 — Compare conflicting papers

File: chain10_step1.json

Question: Two major studies report contradictory results on ctDNA methylation as a biomarker for early-stage non-small cell lung cancer (NSCLC) detection:

Paper A (Nature Medicine 2020, single-center, n=236 NSCLC + 245 controls): A 10-gene methylation panel in cell-free DNA achieved AUC=0.92 for stage I NSCLC vs. healthy controls. Sensitivity 78% at 95% specificity.

Paper B (Lancet Respiratory Medicine 2023, multi-center prospective, n=1,100 NSCLC + 2,200 controls from 12 sites): The SAME 10-gene panel achieved AUC=0.68. Sensitivity 31% at 95% specificity for stage I.

Both used bisulfite sequencing. The specificity-matched sensitivity dropped from 78% → 31%. Provide at least 5 specific reasons for this discrepancy, ranked by likelihood.

Ideal answer:

Overfitting in Paper A. With n=236 cases and a 10-gene panel, there's a high risk that the model was trained and reported on overlapping data (or an insufficiently separated validation set). The effective degrees of freedom may approach the sample size, inflating apparent performance. Paper B's larger, independent cohort reveals the true (lower) performance.
Population heterogeneity. Paper A (single-center) recruited a homogenous population. Paper B (12 sites) includes diverse demographics, comorbidities (COPD, infections — both cause cfDNA methylation changes), and pre-analytical variation. The biomarker likely works well in the specific population of Paper A but doesn't generalize.
Pre-analytical variability across sites. cfDNA is exquisitely sensitive to blood draw technique, processing time, centrifugation protocol, and storage temperature. Multi-site studies inevitably introduce tube-type differences, processing delays, and freeze-thaw cycles that degrade the signal. Bisulfite conversion efficiency may vary across sites.
Spectrum bias (case-mix differences). Paper A may have enriched for higher-volume stage I tumors (T1c vs. T1a) or symptomatic stage I patients. Paper B's prospective design likely includes more incidental findings and smaller tumors with less ctDNA shedding.
Batch effects in bisulfite sequencing. Multi-site sequencing runs (Paper B) introduce systematic batch effects that aren't present in single-center studies. Even with the same protocol, different sequencing instruments and operators produce variable bisulfite conversion rates, read depth, and error profiles.
Publication/optimization bias in Paper A. Researchers may have tested multiple gene panels and reported the best-performing one (researcher degrees of freedom), without correction for multiple comparisons. The "10-gene panel" may be the result of post-hoc optimization that doesn't replicate.

Verification: llm-judge
Cascade risk: Uncritical acceptance → wrong clinical recommendation.

Step 2 — Meta-analytic reasoning

File: chain10_step2.json

Question: Three additional studies have since been published on the same 10-gene ctDNA methylation panel for stage I NSCLC detection:

Study	Design	N (cases+controls)	Sites	AUC	Sensitivity @95% Spec
C	Prospective cohort	180+360	3	0.79	52%
D	Retrospective	95+190	1	0.88	71%
E	Prospective cohort	650+1300	8	0.71	38%

Together with Papers A (AUC=0.92, n=481) and B (AUC=0.68, n=3300): (a) What is your best estimate of the true AUC? (b) What statistical pattern is evident across all 5 studies? (c) How would you formally combine these results, and what method-specific issues apply? (d) If you generated a funnel plot, what would you expect to see?

Ideal answer: (a) Best estimate of true AUC: ~0.70-0.73. Weight heavily toward the larger, prospective, multi-center studies (B and E). A sample-size-weighted average gives approximately: (0.92×481 + 0.68×3300 + 0.79×540 + 0.88×285 + 0.71×1950) / (481+3300+540+285+1950) ≈ 0.72.

(b) Clear small-study effect / inverse correlation between sample size and AUC:

n=285 → AUC 0.88
n=481 → AUC 0.92
n=540 → AUC 0.79
n=1950 → AUC 0.71
n=3300 → AUC 0.68

Smaller studies show systematically higher AUC. This is the classic pattern of publication bias and/or overfitting — small studies with impressive results get published; small studies with modest results don't. Additionally, single-center studies (Papers A, D) outperform multi-center ones (B, C, E), suggesting the performance boost reflects controlled conditions, not generalizable signal.

(c) Formal meta-analysis approach:

Use a bivariate random-effects model (Reitsma model) that jointly models sensitivity and specificity, since they are correlated via the threshold effect
Transform AUC or use paired sensitivity/specificity at the common 95% specificity threshold
Report pooled sensitivity at 95% specificity with 95% CI from the random-effects model
Expect high heterogeneity: I² likely >75%, with τ² reflecting genuine between-study variation
Issue: AUC pooling is problematic because AUC is a summary measure across all thresholds. Pooling sensitivity at a fixed specificity is preferred for clinical interpretation.

(d) Funnel plot expectation: Plot study precision (1/SE or √n) on y-axis vs. effect size (AUC or log-DOR) on x-axis. Expected: asymmetric funnel — small studies (bottom) skewed toward high AUC (right), while large studies (top) cluster around AUC 0.70. A formal test (Deeks' funnel plot asymmetry test for diagnostic studies) would likely be significant (p<0.05), confirming publication bias / small-study effects.

Verification: llm-judge
Cascade risk: Wrong pooled estimate → wrong clinical utility assessment.

Step 3 — Clinical recommendation

File: chain10_step3.json

Question: Based on your synthesis — true AUC likely ~0.70-0.73, sensitivity ~35-40% at 95% specificity for stage I NSCLC, significant small-study bias, high heterogeneity — a clinical advisory committee asks you: (a) Should this 10-gene ctDNA methylation panel be adopted for lung cancer screening? (b) How does it compare to the current standard (low-dose CT, LDCT)? (c) What specific steps would be needed before clinical adoption? (d) Is there any appropriate current use for this biomarker?
Ideal answer: (a) No, the panel should NOT be adopted for population screening at this time. At 35-40% sensitivity (95% specificity) for stage I NSCLC, the test would miss 60-65% of early cancers. For a screening test in a low-prevalence population (~0.5-1% annual incidence among high-risk smokers), the positive predictive value would be unacceptably low and most cancers would be missed.

(b) Comparison to LDCT (NLST and NELSON trials):

LDCT sensitivity for stage I: ~85-95% (vs. 35-40% for ctDNA)
LDCT specificity: ~73-85% (vs. 95% for ctDNA)
ctDNA has HIGHER specificity (fewer false positives) but dramatically LOWER sensitivity
LDCT reduces lung cancer mortality by 20-24% (proven in RCTs); ctDNA panel has no mortality data
ctDNA is less burdensome than CT (blood draw vs. radiation + imaging), but this advantage is moot if it misses most cancers

(c) Steps needed before clinical adoption:

Prospective validation study: n>2,000 high-risk individuals, multi-center (≥15 sites), pre-registered protocol, locked assay and algorithm, independent statistical analysis
Demonstrate added value: ctDNA must improve performance OVER LDCT alone or complement it (e.g., ctDNA to triage LDCT-indeterminate nodules)
Clinical utility trial: Demonstrate that ctDNA-guided management improves outcomes (stage shift or mortality benefit) — not just diagnostic accuracy
Health economic analysis: Cost per QALY gained must be within acceptable thresholds (typically <$100K/QALY for cancer screening)
Standardization: Locked pre-analytical protocol (tube type, processing time, bisulfite conversion kit), certified reference materials, inter-laboratory proficiency testing

(d) Appropriate current use:

Research stratification biomarker: Enrich clinical trial populations for molecular studies
Adjunct to LDCT: Potentially reduce false-positive LDCT rate — if an indeterminate nodule is found on LDCT and ctDNA is negative, it slightly lowers cancer probability (useful given LDCT's ~95% false positive rate for nodule detection). This "rule-in" application exploits the panel's higher specificity
Minimal residual disease (MRD) monitoring: The methylation panel may have better sensitivity in post-surgical surveillance (higher ctDNA shedding in established disease) than in screening — this is a separate clinical question worth pursuing
NOT for standalone screening, second-line testing, or as a replacement for LDCT in any setting
Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Data Type	Identifier	Details	Query Date
Biomarker	10-gene ctDNA methylation panel	Bisulfite sequencing, cfDNA	2026-02-17
Disease	NSCLC (Stage I)	Non-small cell lung cancer, early detection	2026-02-17
Study A	Nature Medicine 2020	Single-center, n=481, AUC=0.92	2026-02-17
Study B	Lancet Resp Med 2023	Multi-center, n=3,300, AUC=0.68	2026-02-17
Study C	Prospective	n=540, 3 sites, AUC=0.79	2026-02-17
Study D	Retrospective	n=285, 1 site, AUC=0.88	2026-02-17
Study E	Prospective	n=1,950, 8 sites, AUC=0.71	2026-02-17
Comparator	LDCT (NLST/NELSON)	Sensitivity 85–95%, specificity 73–85%, mortality reduction 20–24%	2026-02-17

Chain 11: Structure to Drug (4 steps)

structure_to_drug — KRAS G12C covalent inhibition by sotorasib

Step 1 — Identify structural features

File: chain11_step1.json

Question: The crystal structure of KRAS G12C covalently bound to sotorasib (AMG 510) was determined by X-ray diffraction (PDB: 6OIM, resolution 1.65 Å). KRAS is a 189-amino acid GTPase (UniProt P01116). Unlike the EGFR kinase domain in Chain 2, KRAS has historically been considered "undruggable." What structural feature of the G12C mutation specifically enables covalent inhibitor design? Identify the binding pocket sotorasib occupies and explain why this pocket is absent in wild-type KRAS-GTP.
Ideal answer: The G12C mutation replaces the small glycine at position 12 with a cysteine, introducing a nucleophilic thiol group adjacent to the P-loop (phosphate-binding loop, residues 10-17). Sotorasib exploits this by forming an irreversible covalent bond with Cys12 via a Michael acceptor warhead. The compound binds in the Switch II pocket (S-IIP), a cryptic pocket beneath the switch II region (residues 60-75) that is only accessible in the GDP-bound (inactive) conformation. In the GTP-bound state, switch II is ordered and occluded against the effector-binding surface, closing this pocket. In WT KRAS, even in the GDP state, glycine-12 provides no covalent handle — the pocket can open transiently but no selective anchor exists. The S-IIP strategy means sotorasib is a mutation-selective, conformation-selective inhibitor: it traps KRAS G12C in the inactive GDP-bound state, preventing GTP loading and downstream RAS-MAPK signaling.
Verification: llm-judge
Cascade risk: Wrong pocket identification → wrong understanding of selectivity → wrong resistance predictions.

Data Provenance:

PDB 6OIM: Queried 2026-02-17, resolution 1.65 Å, released 2019-11-06, X-ray diffraction. Title: "Crystal Structure of human KRAS G12C covalently bound to AMG 510"
UniProt P01116 (KRAS): 189 aa, queried 2026-02-17
ChEMBL CHEMBL4535757 (sotorasib): IC50 = 68 nM (GTPase KRas, assay CHEMBL4357259); IC50 = 30 nM (KRAS, assay CHEMBL4701894); cellular IC50 = 5 nM (MIA PaCa-2, assay CHEMBL4357260)
Open Targets: KRAS-NSCLC association score = 0.8325 (queried 2026-02-17)

Step 2 — Explain binding mechanism

File: chain11_step2.json

Question: Sotorasib achieves selectivity for KRAS G12C over wild-type KRAS and other G12 mutants (G12D, G12V). ChEMBL data shows sotorasib IC50 = 68 nM against KRAS G12C (CHEMBL4357259) but IC50 > 10,000 nM against wild-type KRAS (CHEMBL4735449) and KRAS G12D. Explain the molecular basis for this >150-fold selectivity window. Why can't sotorasib inhibit KRAS G12D even though both mutants activate the same RAS-MAPK pathway?
Ideal answer: Sotorasib's selectivity has three components: (1) Covalent selectivity: The drug requires Cys12 as a nucleophile for irreversible bond formation. G12D has aspartate, G12V has valine — neither can react with the Michael acceptor. This is absolute selectivity; no amount of dose escalation can overcome it. (2) Conformational selectivity: Sotorasib binds only the GDP-bound state. G12C has the highest intrinsic GTPase rate among oncogenic KRAS mutants (~50% of WT hydrolysis rate), meaning a significant fraction of cellular KRAS G12C cycles through the GDP state. G12D and G12V have much lower GTPase activity (<1% of WT), staying locked in the GTP state where the S-IIP is closed. (3) Pocket complementarity: Even if a non-covalent version of sotorasib were designed, the S-IIP shape is subtly different across mutants due to how residue 12 influences P-loop positioning. The WT glycine at position 12 doesn't create the same pocket geometry. These combined mechanisms make KRAS G12C uniquely druggable among RAS proteins.
Verification: llm-judge
Cascade risk: Wrong selectivity rationale → wrong SAR predictions for next-gen inhibitors.

Data Provenance:

ChEMBL CHEMBL4535757: IC50 = 68 nM (KRAS G12C, CHEMBL4357259), IC50 > 10,000 nM (KRAS WT, CHEMBL4735449), IC50 > 10,000 nM (A549 KRAS G12S, CHEMBL4735451). Queried 2026-02-17.
ChEMBL EC50 data: NCI-H358 (KRAS G12C cell line) EC50 = 6.4 nM (CHEMBL5217982), 6.0 nM (CHEMBL5217992)

Step 3 — SAR prediction

File: chain11_step3.json

Question: Acquired resistance to sotorasib has been observed clinically. Which resistance mechanism would you predict to be MOST difficult to overcome with next-generation KRAS G12C inhibitors? A) Secondary mutations in KRAS at Y96D that sterically block the S-IIP pocket B) Upregulation of SOS1, the KRAS guanine exchange factor, shifting the GTP/GDP equilibrium C) Activating mutations in downstream effectors (BRAF V600E, MEK1 mutations) that bypass KRAS entirely D) Acquisition of a second KRAS G12C allele (gene amplification)
Ideal answer: C. Bypass mutations in downstream effectors are the hardest to overcome because they render KRAS inhibition irrelevant — the pathway is activated independently of KRAS. (A) S-IIP pocket mutations can be addressed by redesigning the non-covalent portion of the inhibitor. (B) SOS1 upregulation shifts KRAS toward GTP-bound state (reducing drug access), but combination with SOS1 inhibitors (e.g., BI-3406) can restore sensitivity. (D) Gene amplification increases target levels but doesn't change the fundamental druggability. Bypass mutations require combination strategies targeting different pathway nodes simultaneously, which is a fundamentally harder pharmacology problem (drug-drug interactions, overlapping toxicity).
Verification: programmatic (multiple_choice: C)
Cascade risk: Wrong resistance hierarchy → wrong clinical strategy.

Data Provenance:

Clinical trial NCT04625647: Phase II, sotorasib in KRAS G12C NSCLC, status ACTIVE_NOT_RECRUITING (queried 2026-02-17)
Clinical trial NCT05398094: Phase II, AMG 510 in Stage III unresectable NSCLC KRAS G12C, RECRUITING (queried 2026-02-17)
Open Targets KRAS-NSCLC: score 0.8325; EGFR-NSCLC: score 0.8850 (queried 2026-02-17)

Step 4 — Experimental validation plan

File: chain11_step4.json

Question: Design a preclinical strategy to evaluate combination therapy of sotorasib + a SOS1 inhibitor to overcome resistance mechanism (B) from Step 3 (SOS1 upregulation shifting KRAS toward GTP-bound state). Specify cell models, assays, dosing strategy, and quantitative success criteria.
Ideal answer: (1) Cell models: NCI-H358 (KRAS G12C, NSCLC), MIA PaCa-2 (KRAS G12C, pancreatic). Generate sotorasib-resistant clones by dose escalation over 3-6 months. Characterize resistance: WES for secondary mutations, RNA-seq for bypass pathway activation, western blot for SOS1/pERK/pAKT levels. Select clones with confirmed SOS1 upregulation (>3-fold by western). (2) Combination viability assay: 8×8 dose matrix of sotorasib (0.3–1000 nM) × SOS1 inhibitor (0.1–3000 nM) in resistant and parental lines, 72h CellTiter-Glo. Calculate Bliss synergy scores. Success: Bliss excess >0.15 at clinically relevant concentrations. (3) Target engagement: In resistant cells treated with combination, measure: (a) RAS-GTP pulldown (RBD assay) — success: >70% reduction in RAS-GTP vs. sotorasib alone; (b) pERK/pAKT western — success: suppression to <20% of vehicle. (4) In vivo: Resistant NCI-H358 xenograft, 4 arms (n=10): vehicle, sotorasib 30 mg/kg QD, SOS1i 100 mg/kg BID, combination. 28-day study. Success: combination achieves >60% TGI when single agents show <20% TGI. Monitor body weight for tolerability.
Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

ChEMBL CHEMBL4535757 sotorasib: MIA PaCa-2 IC50 = 5 nM (CHEMBL4357260), NCI-H358 IC50 = 30 nM (CHEMBL4701895), NCI-H358 IC50 = 16 nM (CHEMBL4735450). Queried 2026-02-17.

Chain 12: Paper to Experiment (4 steps)

paper_to_experiment — JAK2 V617F in myeloproliferative neoplasms

Step 1 — Extract key finding from literature

File: chain12_step1.json

Question: The JAK2 V617F mutation, found in >95% of polycythemia vera and ~50-60% of essential thrombocythemia and primary myelofibrosis, constitutively activates the JAK-STAT signaling pathway. The crystal structure of the JAK2 JH1 kinase domain (PDB: 4IVA, resolution 1.5 Å) reveals the catalytic domain spanning residues 545-809 (UniProt O60674, 1132 aa total), with the active site proton acceptor at Asp976 in the JH1 pseudokinase domain. ClinVar lists 200 pathogenic JAK2 variants. What is the structural mechanism by which the V617F mutation in the JH2 pseudokinase domain (which has no catalytic activity) constitutively activates the JH1 kinase domain?
Ideal answer: In wild-type JAK2, the JH2 pseudokinase domain (residues 545-809) acts as a negative regulator of the JH1 kinase domain (residues 849-1132) through direct physical interaction. Val617 is located in the C-helix of the JH2 domain, at the JH1-JH2 interface. This valine participates in hydrophobic contacts that stabilize the autoinhibitory JH2-JH1 interaction, keeping JH1 in an inactive conformation. The V617F mutation introduces a bulky phenylalanine that disrupts these interface contacts: (1) steric clash destabilizes the JH2-JH1 inhibitory interaction, (2) the phenylalanine may form new intramolecular contacts within JH2 that stabilize a conformation incompatible with JH1 suppression, and (3) loss of autoinhibition results in constitutive JH1 kinase activity, leading to ligand-independent phosphorylation of STATs (primarily STAT5 in erythroid lineage). This drives uncontrolled proliferation of hematopoietic progenitors, producing the MPN phenotype.
Verification: llm-judge
Cascade risk: Wrong mechanism → wrong interpretation of inhibitor resistance.

Data Provenance:

PDB 4IVA: Queried 2026-02-17, resolution 1.5 Å, released 2013-05-22, X-ray. Title: "JAK2 kinase (JH1 domain) in complex with inhibitor"
UniProt O60674 (JAK2): 1132 aa. Domains: FERM (37-380), atypical SH2 (401-482), Protein kinase 1/JH2 (545-809), Active site at 976. Queried 2026-02-17.
ClinVar JAK2: 200 pathogenic variants (queried 2026-02-17 15:55 UTC)
Open Targets JAK2-myelofibrosis: association score = 0.7417 (queried 2026-02-17)

Step 2 — Quantitative data interpretation

File: chain12_step2.json

Question: Ruxolitinib is a JAK1/JAK2 inhibitor approved for myelofibrosis. ChEMBL data shows: ruxolitinib IC50 = 3 nM for JAK1 (CHEMBL1292865), 3 nM for JAK2 (CHEMBL1292866), 430 nM for JAK3 (CHEMBL1292867), and 19 nM for TYK2 (CHEMBL1292868). Calculate the selectivity ratios of JAK2 over JAK3 and TYK2. A patient with myelofibrosis responds to ruxolitinib initially (spleen reduction, symptom improvement) but develops anemia (hemoglobin drops from 10 to 7.5 g/dL). Based on the selectivity profile, explain this clinical observation.
Ideal answer: Selectivity ratios: JAK2/JAK3 = 430/3 = 143-fold; JAK2/TYK2 = 19/3 = 6.3-fold; JAK1/JAK2 = 3/3 = 1:1 (equipotent). The anemia is explained by ruxolitinib's equal potency against JAK2 and JAK1. Normal erythropoiesis depends on erythropoietin (EPO) signaling through JAK2 homodimers on erythroid progenitors. Ruxolitinib cannot selectively inhibit mutant JAK2 V617F vs. wild-type JAK2 — both are inhibited equally at therapeutic doses. This suppresses EPO-driven erythropoiesis, causing/worsening anemia. The spleen response occurs because the MPN clone is exquisitely dependent on JAK2-STAT signaling and is preferentially affected, but normal JAK2-dependent hematopoiesis is collateral damage. This is the fundamental limitation of pan-JAK2 inhibitors — they are pathway inhibitors, not mutation-selective. Dose reduction to manage anemia risks loss of disease control.
Verification: llm-judge
Cascade risk: Wrong selectivity interpretation → wrong prediction of clinical outcomes.

Data Provenance:

ChEMBL CHEMBL1789941 (ruxolitinib): JAK1 IC50 = 3 nM (CHEMBL1292865), JAK2 IC50 = 3 nM (CHEMBL1292866), JAK3 IC50 = 430 nM (CHEMBL1292867), TYK2 IC50 = 19 nM (CHEMBL1292868), JAK1 IC50 = 3.3 nM (replicate, CHEMBL2155753). Max phase = 4 (approved). Queried 2026-02-17.
Open Targets JAK2-myelofibrosis: 0.7417; MPL-myelofibrosis: 0.7375; CALR-myelofibrosis: 0.5646 (queried 2026-02-17)

Step 3 — Statistical test selection

File: chain12_step3.json

Question: You are analyzing a retrospective cohort of 85 myelofibrosis patients treated with ruxolitinib. You want to test whether baseline JAK2 V617F allele burden (measured by quantitative PCR, continuous variable from 0-100%) predicts spleen response at 24 weeks (≥35% reduction, binary yes/no). You also want to assess whether allele burden predicts time-to-response and whether initial allele burden trajectory (change in allele burden at weeks 4, 8, 12) provides additional predictive value beyond baseline. What statistical framework addresses all three questions?
Ideal answer: (1) Baseline allele burden → binary spleen response: Logistic regression with allele burden as continuous predictor. Report odds ratio per 10% increase in allele burden, with 95% CI. Check linearity assumption using restricted cubic splines — if non-linear, use spline logistic regression. (2) Allele burden → time-to-response: Cox proportional hazards model with allele burden as continuous covariate. Check PH assumption with Schoenfeld residuals. Report hazard ratio per 10% allele burden increase. Kaplan-Meier curves stratified by tertiles of allele burden for visualization. (3) Trajectory analysis: Joint longitudinal-survival model (JM package in R) that simultaneously models: (a) the longitudinal trajectory of allele burden (linear mixed-effects model with random intercept and slope), and (b) time-to-spleen response (Cox model). The joint model links the current value and/or slope of allele burden to the hazard of response, properly accounting for measurement error and informative dropout. This is superior to landmark analysis or time-varying Cox because it handles irregular measurement times and extrapolation. Do not use repeated t-tests comparing responders vs. non-responders at each timepoint — this ignores the time series structure and inflates type I error.
Verification: llm-judge
Cascade risk: Wrong model → biased estimates → wrong clinical thresholds.

Step 4 — Hypothesis generation

File: chain12_step4.json

Question: Based on your analysis — JAK2 V617F drives MPN through constitutive JH1 activation via JH2 interface disruption, ruxolitinib inhibits WT and mutant JAK2 equally (causing anemia), and allele burden trajectory may predict response — propose 3 approaches to develop a mutation-selective JAK2 V617F inhibitor that spares wild-type JAK2 and thus preserves normal erythropoiesis.
Ideal answer: (1) Target the JH2-JH1 interface directly: Design compounds that stabilize the autoinhibitory JH2-JH1 interaction in the WT conformation. V617F disrupts this interface, so molecules that bind and stabilize the WT interface would preferentially inhibit cells lacking functional autoinhibition (i.e., V617F-expressing cells would still escape, requiring careful design). Alternatively, target the unique V617F-disrupted interface as a neo-pocket. (2) Mutant-selective type II inhibitor: Exploit the possibility that V617F alters the DFG motif equilibrium in JH1. If V617F shifts JH1 toward the DFG-out state more than WT (due to altered JH2 regulation), a type II inhibitor optimized for this specific DFG-out geometry could achieve selectivity. Analogous to how ponatinib selectively inhibits BCR-ABL T315I. Screen using differential scanning calorimetry (DSC) comparing compound binding to V617F vs. WT JH1-JH2 constructs. (3) PROTAC degrader approach: Design a PROTAC that binds JAK2 and recruits an E3 ligase (e.g., cereblon via thalidomide analog). If the PROTAC achieves preferential degradation of V617F JAK2 — exploiting different surface accessibility or stability of the mutant — it could selectively deplete the oncogenic protein. Even if binding affinity is similar, degradation kinetics may differ due to conformational differences affecting ubiquitination sites. This approach is being explored for several "undruggable" targets and would convert a pathway inhibitor into a mutation-specific one.
Verification: llm-judge
Cascade risk: Terminal step.

Chain 13: Stats Pipeline (3 steps)

stats_pipeline — GWAS meta-analysis for type 2 diabetes risk loci

Step 1 — Choose statistical framework

File: chain13_step1.json

Question: You are conducting a GWAS meta-analysis for type 2 diabetes (T2D) risk, combining three cohorts: (1) European ancestry, n=50,000 cases + 100,000 controls; (2) East Asian ancestry, n=30,000 cases + 60,000 controls; (3) African ancestry, n=8,000 cases + 16,000 controls. Each cohort has been genotyped on different arrays and imputed to different reference panels. You have summary statistics (beta, SE, p-value, allele frequencies) for ~8 million variants from each cohort. The Open Targets association for T2D lists IFNAR2 (0.6094), IFNAR1 (0.6077), and IMPDH1 (0.6057) as top targets, suggesting immune pathways. What meta-analysis approach should you use, and why is a simple fixed-effects model insufficient here?
Ideal answer: Use a random-effects meta-analysis (specifically, the Han-Eskin model or METASOFT MRE) because: (1) Effect size heterogeneity across ancestries is expected — allele frequencies, LD patterns, and environmental modifiers differ between populations. A fixed-effects model assumes identical true effect sizes across studies, which is biologically implausible for a polygenic trait across diverse ancestries. (2) Different LD patterns mean different causal variant tagging: A lead SNP in Europeans may not tag the same causal variant in Africans. African populations have shorter LD blocks (due to deeper genetic diversity), providing better fine-mapping resolution but potentially different association statistics at the same SNP. (3) Use inverse-variance weighted random-effects (DerSimonian-Laird or REML-based), reporting both the pooled effect and heterogeneity metrics (I², Cochran's Q, τ²). For SNPs with I² > 50%, examine ancestry-specific effects — these are candidates for population-specific regulatory mechanisms. (4) Trans-ancestry fine-mapping should use tools like PAINTOR or MR-MEGA that explicitly model ancestral differences in LD. (5) Do not simply combine summary statistics with fixed-effects METAL — this inflates significance for SNPs with consistent effects while masking true signals that are ancestry-specific. The African cohort, despite being smallest, contributes disproportionate fine-mapping value due to shorter LD.
Verification: llm-judge
Cascade risk: Wrong meta-analysis model → inflated or missed signals → wrong loci prioritization.

Data Provenance:

Open Targets T2D (EFO_0004220): top targets IFNAR2 (0.6094), IFNAR1 (0.6077), IMPDH1 (0.6057). Queried 2026-02-17.
ClinVar TP53 total variants: 3,912; pathogenic: 1,705 (queried 2026-02-17)

Step 2 — Multiple testing correction

File: chain13_step2.json

Question: Your random-effects meta-analysis identifies 412 loci reaching genome-wide significance (p < 5×10⁻⁸). Of these, 380 replicate known T2D loci and 32 are novel. A reviewer asks: "The genome-wide significance threshold of 5×10⁻⁸ was derived for European populations based on ~1 million independent common variants. With 8 million imputed variants across three ancestries, shouldn't you use a more stringent threshold?" (a) Is the reviewer correct? (b) Calculate the appropriate Bonferroni threshold for 8 million tests. (c) How many of the 32 novel loci would survive this threshold if their p-values range from 1.2×10⁻⁸ to 4.8×10⁻⁸? (d) What is the better approach than adjusting the threshold?
Ideal answer: (a) The reviewer raises a valid point but the conclusion is partially wrong. The 5×10⁻⁸ threshold approximates a Bonferroni correction for ~1 million independent common variants in European LD structure (0.05/10⁶ ≈ 5×10⁻⁸). With imputed and multi-ancestry data, the number of effectively independent tests increases. However, the increase is not proportional to total variants because most of the 8 million variants are in LD with each other. (b) Bonferroni for 8M tests: 0.05 / 8×10⁶ = 6.25×10⁻⁹. This is ~8× more stringent than the standard threshold. (c) If the 32 novel loci have p-values from 1.2×10⁻⁸ to 4.8×10⁻⁸, zero survive a threshold of 6.25×10⁻⁹. But Bonferroni is overly conservative here because it ignores LD. (d) Better approaches: (i) Calculate the effective number of independent tests using eigenvalue decomposition of the LD matrix (simpleM or LDAK), which will yield ~2-3 million independent tests across ancestries, corresponding to a threshold of ~1.5-2.5×10⁻⁸. Some novel loci may survive this. (ii) Use a Bayesian framework (e.g., FINEMAP, SuSiE) that assigns posterior inclusion probabilities to each variant, avoiding arbitrary thresholds entirely. (iii) Require replication: the novel loci should be validated in an independent cohort — if 20+ of 32 replicate at p<0.05 (directionally consistent), this provides stronger evidence than any significance threshold.
Verification: llm-judge
Cascade risk: Wrong threshold → miss true signals or accept false positives.

Step 3 — Pathway interpretation

File: chain13_step3.json

Question: MAGMA gene-set analysis on the 412 T2D loci identifies these enriched pathways:

Pathway	P_adj	# Genes	Enrichment
Insulin secretion regulation	3.2×10⁻¹⁵	45	4.1×
Pancreatic beta cell development	7.8×10⁻¹¹	28	3.6×
Type I interferon signaling	1.4×10⁻⁷	19	2.8×
Adipocyte differentiation	5.6×10⁻⁶	22	2.3×
Circadian rhythm regulation	2.3×10⁻⁴	11	2.0×
Mitochondrial electron transport	0.012	8	1.5×

The interferon signaling result is unexpected for T2D — your collaborator suggests it is an artifact. However, Open Targets independently identifies IFNAR2 and IFNAR1 as top T2D associations. Evaluate whether the interferon signal is real or artifact, and explain the potential biological connection.

Ideal answer: The interferon signal is likely real, not an artifact. Evidence: (1) Independent convergence: GWAS loci enriched for interferon genes AND Open Targets independently identifies IFNAR1/2 as top T2D associations from orthogonal data (genetic associations, expression, literature). This convergence from different methodologies strongly supports a genuine signal. (2) Biological plausibility: Type I interferons (IFNα/β) are increasingly recognized in T2D pathogenesis. IFN signaling in pancreatic beta cells induces ER stress and apoptosis, contributing to beta cell loss. In obesity, chronic low-grade inflammation involves IFN-stimulated gene expression in adipose tissue macrophages. Viral infections triggering IFN responses are linked to diabetes onset (enterovirus → type 1 diabetes; HCV → T2D). (3) Statistical robustness: p = 1.4×10⁻⁷ with 19 genes and 2.8× enrichment is highly significant and well above the marginal pathway results.

However, consider potential confounds: The IFNAR1/IFNAR2 locus on chromosome 21q22 is in a region with complex LD and multiple genes. The T2D signal may reflect LD with nearby genes (e.g., IL10RB) rather than IFNAR itself. Fine-mapping with ancestry-specific LD (leveraging the African cohort's short LD blocks) is needed to distinguish causal genes.

Biological ranking: (1) Insulin secretion + beta cell development = core T2D pathophysiology; (2) Interferon signaling + adipocyte differentiation = immune/metabolic crosstalk; (3) Circadian rhythm = plausible (sleep disruption → insulin resistance); (4) Mitochondrial transport = marginal (p=0.012, low enrichment).

Verification: llm-judge
Cascade risk: Terminal step.

Chain 14: Critical Appraisal (3 steps)

critical_appraisal — Lecanemab efficacy in early Alzheimer's disease

Step 1 — Evaluate strength of evidence

File: chain14_step1.json

Question: The Clarity AD trial (Phase III, n=1,795) reported that lecanemab, an anti-amyloid-beta antibody, slowed cognitive decline by 27% compared to placebo on the CDR-SB score (Clinical Dementia Rating-Sum of Boxes) over 18 months in early Alzheimer's disease. The difference was: lecanemab CDR-SB change = +1.21; placebo = +1.66; difference = -0.45 points (p<0.001). Amyloid PET showed significant plaque reduction. However, CDR-SB ranges from 0-18, and the minimal clinically important difference (MCID) is debated (0.5-1.0 points). Cryo-EM structures of amyloid-beta fibrils exist (PDB structure 9CZI, 3.0 Å resolution, tau paired helical filaments in AD brains). ClinVar lists 131 pathogenic APP variants and 196 pathogenic PSEN1 variants. Is the 27% slowing clinically meaningful?
Ideal answer: This requires nuanced evaluation — the statistical significance is clear but clinical meaningfulness is debatable:

Arguments FOR clinical meaningfulness:

The 27% relative reduction is consistent and reproducible (similar to donanemab trial results), establishing the amyloid hypothesis has therapeutic validity.
The effect appears to increase over time — the divergence between curves is widening at 18 months, suggesting longer treatment may yield larger absolute differences.
Subgroup analyses show larger effects in ApoE4 carriers and earlier-stage patients.
Biomarker confirmation: amyloid plaque reduction, p-tau reduction, and plasma biomarker changes provide mechanistic validation.

Arguments AGAINST clinical meaningfulness:

Absolute difference of 0.45 CDR-SB points is below the commonly cited MCID of 0.5-1.0. On an 18-point scale, 0.45 points may not be perceptible to patients or caregivers.
No functional milestone delayed: The trial did not demonstrate delay in progression from MCI to dementia, ability to maintain ADLs, or delay of institutionalization.
Safety trade-off: ARIA-E (amyloid-related imaging abnormalities, edema) occurred in 12.6% of lecanemab vs. 1.7% placebo. ARIA-H (hemorrhage) in 17.3% vs. 9.0%. Three deaths potentially linked to treatment (ARIA-related brain hemorrhage, including one on anticoagulants).
Cost-benefit: At ~$26,500/year plus monitoring MRIs, the cost per QALY likely exceeds $100-200K for a 0.45-point CDR-SB difference.

Conclusion: The evidence establishes proof-of-concept for anti-amyloid therapy but does not yet demonstrate clinically meaningful individual patient benefit. The 27% number is statistically robust but may be misleading — "27% slower decline" sounds dramatic while "0.45 CDR-SB points on an 18-point scale" sounds modest.

Verification: llm-judge
Cascade risk: Uncritical acceptance → wrong framework for interpreting combination trial data.

Data Provenance:

PDB 9CZI: Queried 2026-02-17, resolution 3.0 Å, released 2024-10-02, cryo-EM. Title: "Paired helical tau filaments in dominantly inherited Alzheimer disease with cotton wool plaques"
ClinVar APP: 131 pathogenic variants; PSEN1: 196 pathogenic variants (queried 2026-02-17 15:55 UTC)
Clinical trial NCT05999084: Lecanemab registry, RECRUITING (queried 2026-02-17)
Clinical trial NCT06602258: E2814 + lecanemab, Phase II, ACTIVE_NOT_RECRUITING (queried 2026-02-17)

Step 2 — Integrate contradictory evidence

File: chain14_step2.json

Question: A subsequent real-world evidence study (n=3,200 patients across 45 US memory clinics, 12-month follow-up) reports: CDR-SB change in lecanemab-treated patients = +1.8 (vs. +1.66 for placebo in Clarity AD at 18 months). ARIA-E rate = 15.8% (vs. 12.6% in the trial). 22% of patients discontinued within 6 months (infusion burden, ARIA, or lack of perceived benefit). The study notes that real-world patients are older (mean 78 vs. 72 in Clarity AD), have more comorbidities, and 34% are on anticoagulants. How does this change your assessment?
Ideal answer: This substantially weakens the real-world case for lecanemab:

Worse outcomes than placebo arm of Clarity AD: Real-world lecanemab patients declined +1.8 CDR-SB in 12 months, which extrapolates to ~2.7 at 18 months — worse than the Clarity AD placebo arm (+1.66 at 18 months). However, this comparison is confounded by the older, sicker real-world population who would be expected to decline faster regardless.
Higher ARIA rate (15.8% vs. 12.6%) likely reflects older patients with more cerebrovascular disease and anticoagulant use. The 34% on anticoagulants is alarming given the 3 ARIA-related deaths in Clarity AD included anticoagulated patients.
High discontinuation (22% by 6 months) reveals a practical effectiveness-efficacy gap. Intent-to-treat efficacy trials capture a best-case scenario; real-world adherence is worse.
Selection bias: Real-world patients were not selected by biomarker-confirmed early AD — some may have mixed dementia, vascular contributions, or more advanced disease, all of which would dilute amyloid-specific effects.
Updated conclusion: The Clarity AD trial result may be valid for its narrow population (biomarker-confirmed early AD, age ~72, no anticoagulants) but does not generalize well. The 0.45 CDR-SB benefit may not manifest in typical clinical patients. Treatment guidelines should emphasize strict patient selection criteria matching trial eligibility.

Verification: llm-judge
Cascade risk: Failure to account for efficacy-effectiveness gap → inappropriate treatment recommendations.

Step 3 — Design definitive experiment

File: chain14_step3.json

Question: Based on your analysis — modest clinical benefit in selected patients, poor real-world generalization, amyloid reduction confirmed but functional impact unclear — design a trial that would definitively establish whether amyloid-clearing therapy provides clinically meaningful benefit. Specify: patient selection, endpoint, comparator, duration, and key design features.
Ideal answer: Adaptive platform trial testing amyloid clearance + downstream combination:

Population: Biomarker-confirmed early AD (positive amyloid PET AND p-tau181/217 >2× ULN), age 60-80, MMSE 22-30, CDR-global 0.5-1.0. Exclude anticoagulant users and those with >4 microbleeds on baseline MRI.

Design: 2×2 factorial, adaptive with interim futility analysis at 12 months:

Arm 1: Lecanemab + placebo tau (anti-amyloid alone)
Arm 2: Lecanemab + anti-tau antibody (e.g., E2814; combination)
Arm 3: Anti-tau antibody alone
Arm 4: Placebo + placebo

Primary endpoint: Time to progression from MCI to dementia (CDR-global 0 to ≥1, or CDR-global 0.5 to ≥1.0 confirmed at 2 consecutive visits) — this is a functional milestone that patients and caregivers understand, not a continuous scale score.

Key secondary: CDR-SB at 36 months, ADAS-Cog14, Amsterdam IADL, quality-adjusted life years (QALYs).

Duration: 36 months (vs. 18 in Clarity AD). The widening treatment-placebo curves suggest longer observation is critical.

Sample size: n=1,200 per arm (4,800 total), powered at 80% to detect a 25% relative reduction in dementia conversion (estimated ~40% conversion in placebo over 3 years → ~30% in treatment arm).

Design features: (1) Stratify by ApoE4 status, baseline CDR, age. (2) Pre-registered digital biomarkers (smartphone cognitive tests, actigraphy) as exploratory endpoints. (3) Independent DSMB with stopping rules for ARIA-related SAEs. (4) Built-in health economic analysis: track all costs (drug, MRIs, hospitalizations) for cost-effectiveness.

Decision criterion: If neither lecanemab alone nor combination delays dementia conversion at 36 months, the amyloid-clearance strategy should be deprioritized in favor of downstream targets.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 15: Genetics to Therapy (3 steps)

genetics_to_therapy — CFTR F508del in cystic fibrosis

Step 1 — Gene function and disease mechanism

File: chain15_step1.json

Question: Cystic fibrosis (CF) is caused by mutations in CFTR (UniProt P13569, 1480 aa), which functions as a chloride and bicarbonate channel. The cryo-EM structure of dephosphorylated, ATP-free human CFTR (PDB: 5UAK, resolution 3.87 Å) reveals two ABC transmembrane domains (TMD1: residues 81-365; TMD2: 859-1155) and two ABC transporter/nucleotide-binding domains (NBD1: 423-646; NBD2: 1219-1480). ClinVar lists 2,152 pathogenic CFTR variants out of 6,170 total. The F508del mutation (deletion of phenylalanine at position 508 in NBD1) accounts for ~70% of CF alleles worldwide. Open Targets confirms CFTR as the primary cystic fibrosis target. What are the two distinct molecular consequences of F508del, and why does this make it harder to treat than a simple channel-gating mutation like G551D?
Ideal answer: F508del causes two distinct molecular defects that require different pharmacological corrections:

(1) Protein folding/trafficking defect (Class II): Phe508 is located on the surface of NBD1, at the interface between NBD1 and intracellular loop 4 (ICL4) of TMD2. It participates in hydrophobic packing interactions critical for the NBD1-ICL4 interface. Deleting F508 disrupts this interface, causing: (a) local NBD1 misfolding with reduced thermal stability (ΔTm ≈ -6°C), (b) failure to properly assemble the NBD1-TMD2 domain interface, and (c) recognition by ER quality control (calnexin/calreticulin cycle, CHIP E3 ligase) → ubiquitination → proteasomal degradation. Result: <2% of F508del-CFTR reaches the cell surface.

(2) Channel gating defect (Class III): The small fraction of F508del-CFTR that escapes ER degradation and reaches the plasma membrane has severely impaired channel gating — reduced open probability (Po) ~10% of WT due to disrupted NBD1-NBD2 dimerization needed for channel opening.

Comparison to G551D: G551D is a pure Class III (gating) mutation — the protein folds normally and traffics to the surface, but the channel doesn't open properly. A single drug (potentiator, e.g., ivacaftor) that enhances gating is sufficient. F508del requires triple combination therapy: corrector 1 (elexacaftor, stabilizes NBD1-TMD interface) + corrector 2 (tezacaftor, stabilizes NBD1 fold) + potentiator (ivacaftor, enhances gating of rescued protein). This explains why Trikafta (elexacaftor/tezacaftor/ivacaftor) was the breakthrough — single agents failed because they addressed only one of the two defects.

Verification: llm-judge
Cascade risk: Wrong defect classification → wrong therapeutic logic.

Data Provenance:

PDB 5UAK: Queried 2026-02-17, resolution 3.87 Å, released 2017-01-18, cryo-EM. Title: "Dephosphorylated, ATP-free human cystic fibrosis transmembrane conductance regulator (CFTR)"
UniProt P13569 (CFTR): 1480 aa. Domains: ABC TMD1 (81-365), ABC transporter 1 (423-646), ABC TMD2 (859-1155). Queried 2026-02-17.
ClinVar CFTR: 2,152 pathogenic variants, 6,170 total variants (queried 2026-02-17 15:55 UTC)
ChEMBL CHEMBL2010601 (ivacaftor): max_phase = 4. Queried 2026-02-17.
Clinical trial NCT05668741: VX-522 in CF, Phase 1/2, RECRUITING (queried 2026-02-17)

Step 2 — Structural consequence of mutation

File: chain15_step2.json

Question: The Trikafta triple combination restores ~50% of wild-type CFTR function in F508del/F508del patients. However, ~10% of CF patients carry mutations in both alleles that are not responsive to modulators (e.g., nonsense mutations like G542X creating premature stop codons, or splice mutations). For a patient compound heterozygous for F508del/G542X, Trikafta can only rescue the F508del allele. Given that normal CFTR chloride conductance requires proper channel assembly and ~50% of WT function is the threshold for avoiding significant lung disease, estimate whether rescuing one allele is sufficient and what additional strategies could help.
Ideal answer: One-allele rescue with Trikafta provides partial but likely insufficient benefit:

Quantitative estimate: Each allele contributes ~50% of total CFTR mRNA. The G542X allele produces no functional protein (nonsense-mediated mRNA decay + truncated non-functional protein). The F508del allele with Trikafta: baseline ~2% trafficking × Trikafta rescue to ~50% of WT per-molecule function × some increase in surface trafficking (Trikafta raises to ~40-60% of WT surface levels). Net: ~25-30% of WT function from the rescued F508del allele alone.

Clinical prediction: 25-30% of WT function is in the "borderline" zone. Patients with >50% function are asymptomatic; 25-50% may have mild disease. This patient would likely see improvement (reduced sweat chloride, improved FEV1) but not normalization.

Additional strategies for the G542X allele:

Readthrough agents: Ataluren (PTC124) promotes ribosomal readthrough of premature stop codons. Could partially restore full-length CFTR from the G542X allele. However, clinical trials showed limited efficacy (Phase III failed primary endpoint).
mRNA therapy: Nebulized lipid nanoparticle-delivered CFTR mRNA to airway epithelium. Provides transient WT CFTR expression independent of genotype. Currently in Phase I/II trials (e.g., MRT5005).
Gene editing: CRISPR-based correction of G542X in airway basal stem cells ex vivo, followed by re-engraftment. Technically feasible but delivery to sufficient airway surface remains unsolved.
NMD inhibition + Trikafta: If G542X mRNA is stabilized by NMD inhibition, the truncated protein may still not function — but if any readthrough occurs, Trikafta could then help fold/gate the full-length protein produced.

Verification: llm-judge
Cascade risk: Wrong rescue estimate → wrong clinical expectation.

Step 3 — Therapeutic strategy

File: chain15_step3.json

Question: Next-generation CFTR modulators aim to achieve >80% of WT function for F508del patients. The current Trikafta achieves ~50%. What specific molecular targets within the CFTR folding/trafficking pathway could a fourth drug component address to close this gap? Propose two distinct strategies with mechanisms and measurable endpoints.
Ideal answer: Strategy 1 — Enhance ER proteostasis to reduce F508del degradation: The remaining F508del-CFTR that isn't rescued by Trikafta is being degraded by the CHIP/Hsp70-mediated ER quality control pathway. Inhibiting CHIP (STUB1) E3 ligase activity or modulating Hsp70/Hsp90 chaperone interactions could increase the fraction of F508del-CFTR that escapes ER retention. Specifically, small-molecule inhibitors of the Hsp70-CHIP interaction would block ubiquitination of partially misfolded CFTR without globally disrupting protein homeostasis. Endpoint: Measure F508del-CFTR surface expression by cell-surface biotinylation in primary human bronchial epithelial cells (HBE) from F508del homozygous patients. Success: Trikafta + CHIP inhibitor achieves >70% of WT surface CFTR (vs. ~50% with Trikafta alone). Monitor unfolded protein response (UPR) markers to ensure no proteotoxic stress.

Strategy 2 — Stabilize rescued F508del-CFTR at the plasma membrane: Even CFTR that reaches the surface with Trikafta has reduced stability and is endocytosed and degraded faster than WT (half-life ~4h vs. ~16h for WT). A "stabilizer" that enhances CFTR-NHERF1 PDZ interaction (the C-terminal PDZ-binding motif DTRL anchors CFTR to the apical membrane via NHERF1/EBP50 scaffold) or inhibits endocytic retrieval could extend surface residence time. Endpoint: Measure CFTR surface half-life by pulse-chase surface biotinylation. Success: half-life increased from ~4h to >10h. Functional confirmation: Ussing chamber short-circuit current (Isc) in HBE monolayers showing sustained chloride secretion over 24h (currently declines as rescued CFTR is internalized).

Verification: llm-judge
Cascade risk: Terminal step.

Chain 16: Protocol Troubleshoot (3 steps)

protocol_troubleshoot — ChIP-seq for H3K27me3 in embryonic stem cells

Step 1 — Diagnose protocol error

File: chain16_step1.json

Question: You are performing ChIP-seq for the repressive histone mark H3K27me3 in mouse embryonic stem cells (mESCs) to map Polycomb-repressed domains. Your protocol: crosslink with 1% formaldehyde 10 min, sonicate to 200-500 bp, immunoprecipitate with anti-H3K27me3 antibody (Cell Signaling #9733) overnight at 4°C with protein A/G beads, wash 4× with RIPA buffer, reverse crosslinks, purify DNA, library prep, sequence 40M reads. Result: The sequencing data shows: (a) only 2.8% of reads map to known H3K27me3-enriched regions (expected: >20%), (b) the FRiP (Fraction of Reads in Peaks) is 0.04 (expected: >0.15), (c) MACS2 calls only 1,200 broad peaks (expected: >15,000 broad domains), (d) input control looks normal. Antibody lot was validated by western blot (correct band at ~17 kDa). What is the most likely cause of failure?
Ideal answer: The most likely cause is over-sonication destroying the H3K27me3 epitope and/or fragmenting chromatin below the optimal size for broad mark ChIP. H3K27me3 is a broad histone mark covering large genomic domains (often 10-100 kb), fundamentally different from sharp transcription factor binding sites. Several specific issues:

Sonication for broad marks should produce larger fragments (500-1000 bp), not 200-500 bp. The 200-500 bp range is optimal for transcription factor ChIP-seq. Broad marks like H3K27me3 require larger fragments because: (a) larger fragments improve signal-to-noise for diffuse enrichment, (b) excessive sonication can destroy histone modifications or cross-epitope relationships.
4× RIPA washes are too stringent for histone ChIP. RIPA contains 0.1% SDS + 0.5% deoxycholate, which can strip weakly bound chromatin. H3K27me3 ChIP should use milder wash buffers (low-salt wash, LiCl wash, TE — the standard histone ChIP wash series).
Crosslinking may also be an issue: 10 min at 1% formaldehyde is standard for TF-ChIP but may be excessive for histone ChIP (where histones are already tightly bound to DNA). Over-crosslinking reduces sonication efficiency and can mask epitopes.

Fix: (1) Reduce sonication to produce 500-1000 bp fragments (or use MNase digestion for native ChIP). (2) Switch to milder washes (150 mM NaCl, no SDS). (3) Reduce crosslinking to 5 min or try native ChIP (no crosslinking — histones don't need it). (4) Consider CUT&Tag as an alternative — it's specifically designed for histone marks and requires far fewer cells.

Verification: llm-judge
Cascade risk: Wrong diagnosis → continued failure → project delay.

Step 2 — Interpret corrected result

File: chain16_step2.json

Question: After switching to MNase digestion (producing mono- to tri-nucleosomal fragments, 150-500 bp) and milder washes (150 mM NaCl), your new ChIP-seq data shows: FRiP = 0.22, MACS2 (broad mode) calls 18,500 broad peaks. However, quality metrics reveal: (a) PCR duplicate rate = 38% (expected: <20%), (b) library complexity (estimated by Picard) is only 0.4 (expected: >0.8), (c) after deduplication, effective read depth drops from 40M to 25M. What happened, and is the data still usable?
Ideal answer: The high duplicate rate (38%) and low library complexity (0.4) indicate that you had insufficient ChIP DNA for library preparation, resulting in over-amplification during PCR. In ChIP-seq, the IP yield can be very low (1-10 ng); if <1 ng of DNA enters library prep, excessive PCR cycles (>15) are needed, creating many duplicate molecules from limited template.

Is the data usable? Partially. After deduplication, 25M unique reads with FRiP=0.22 gives ~5.5M reads in peaks. For broad marks like H3K27me3, ENCODE recommends >20M unique reads (ideally 40-60M for broad peaks). At 25M unique, you can: (a) identify most major H3K27me3 domains, (b) perform differential analysis between conditions with reduced power, (c) not reliably detect subtle domain boundary shifts or quantitative changes.

Remediation: (1) Re-sequence the same library to increase total reads (won't help — same duplicates will be sequenced again). (2) Prepare a new library from a new ChIP experiment, starting with more cells (>10M instead of typical 1M for histone ChIP) to increase IP yield. (3) Use a library prep kit designed for low-input (e.g., NEBNext Ultra II, ThruPLEX) that requires fewer PCR cycles. (4) Add a UMI (unique molecular identifier) adapter during library prep to distinguish true duplicates from PCR duplicates. (5) For future experiments, consider CUT&Tag, which requires only 100K cells and generates lower background.

Verification: llm-judge
Cascade risk: Wrong QC interpretation → publish artifacts as biology.

Step 3 — Quantitative follow-up

File: chain16_step3.json

Question: You successfully repeat the ChIP-seq with CUT&Tag (100K mESCs, anti-H3K27me3) and obtain high-quality data: 30M unique reads, FRiP=0.35, 22,000 broad peaks. You want to compare H3K27me3 domains between: (a) naive mESCs (2i+LIF), (b) primed mESCs (activin+FGF), and (c) mESCs with EZH2 catalytic-dead mutation (SET domain Y641F — this is the PRC2 methyltransferase). Describe the analysis pipeline and the expected differences with biological rationale.
Ideal answer: Analysis pipeline:

Alignment: Bowtie2 to mm10, remove duplicates (Picard), filter MAPQ≥30
Peak calling: MACS2 broad mode (--broad --broad-cutoff 0.1) for each sample. Also use SICER2 (designed for broad histone marks) for comparison.
Differential analysis: DiffBind or MAnorm2 for quantitative comparison of H3K27me3 signal across conditions. Use spike-in normalization (add Drosophila chromatin + anti-H2Av antibody to each CUT&Tag) to control for global changes in H3K27me3 levels.
Visualization: deepTools computeMatrix → plotHeatmap at TSSs, showing H3K27me3 signal ±10 kb around all gene promoters, sorted by signal intensity.
Gene set overlap: Intersect differential H3K27me3 domains with gene annotations to identify genes gaining/losing Polycomb repression.

Expected differences:

Naive → Primed: Gain of H3K27me3 at developmental gene promoters (e.g., Hox clusters, lineage-specific TFs) as cells become more restricted. Loss of H3K27me3 at pluripotency-associated bivalent promoters that resolve to active state. Overall H3K27me3 domain count should increase by ~20-30%.
EZH2-Y641F catalytic-dead: Near-complete loss of H3K27me3 genome-wide (EZH2 is the sole H3K27me3 methyltransferase in PRC2). Expect >90% reduction in peak count and signal intensity. This is the negative control confirming antibody specificity and CUT&Tag performance. Residual signal may come from: (a) EZH1 compensation (the paralog has weak H3K27 methyltransferase activity), (b) antibody background.
Critical control: The EZH2 mutant validates the entire experiment — if substantial H3K27me3 signal remains, either the mutation is leaky, EZH1 compensates, or the antibody has off-target binding.
Verification: llm-judge
Cascade risk: Terminal step.

Chain 17: Paradox Resolution (3 steps)

paradox_resolution — PD-1 blockade accelerates tumor growth (hyperprogression)

Step 1 — Explain paradoxical result

File: chain17_step1.json

Question: Anti-PD-1 immunotherapy (pembrolizumab, nivolumab) produces durable responses in ~20-30% of patients across multiple cancer types. However, ~10-15% of patients experience hyperprogressive disease (HPD) — tumor growth rate accelerates ≥2-fold after starting anti-PD-1, faster than pre-treatment kinetics. The crystal structure of PD-1/PD-L1 complex (PDB: 4ZQK, resolution 2.45 Å) shows the extracellular interaction interface. ClinVar lists 1,705 pathogenic TP53 variants and 1,922 pathogenic PTEN variants, both of which are enriched in HPD tumors. Propose at least 3 mechanistic hypotheses for how blocking PD-1 (which should release anti-tumor immunity) paradoxically accelerates tumor growth. Rank by evidence strength.
Ideal answer: Hypothesis 1 (Strongest evidence): PD-1 blockade activates regulatory T cells (Tregs) and immunosuppressive populations. PD-1 is expressed not only on effector CD8+ T cells but also on Tregs, exhausted CD4+ cells, and macrophages. In tumors where Tregs constitute a large fraction of tumor-infiltrating lymphocytes, PD-1 blockade may disproportionately activate Tregs (which suppress anti-tumor immunity) over effectors. If the Treg:effector ratio is unfavorable, net immunosuppression increases. Evidence: HPD correlates with high pre-treatment Treg infiltration and FoxP3+ expansion after anti-PD-1.

Hypothesis 2 (Moderate evidence): PD-1 blockade on macrophages promotes M2 polarization and tumor-promoting inflammation. Tumor-associated macrophages (TAMs) express PD-1; PD-1 signaling restrains their phagocytic activity but also limits inflammatory cytokine production. Blocking PD-1 on TAMs may shift them toward an M2-like program producing growth factors (VEGF, EGF, TGF-β) and matrix metalloproteinases that promote invasion. This is context-dependent — in some tumors, PD-1 blockade enhances phagocytosis (beneficial); in others, it may trigger a wound-healing inflammatory cascade (detrimental).

Hypothesis 3 (Emerging evidence): Fc-receptor-mediated antibody effects. Anti-PD-1 antibodies (IgG4 for pembrolizumab, IgG4 for nivolumab) can engage Fc receptors on macrophages. In some contexts, this may: (a) induce ADCP (antibody-dependent cellular phagocytosis) of PD-1+ effector T cells, depleting them; (b) trigger Fc-mediated crosslinking of inhibitory receptors on myeloid cells. The net effect is depletion of the very effector cells needed for anti-tumor immunity, while leaving tumor cells untouched.

Hypothesis 4 (Correlative): Genomic context — MDM2/MDM4 amplification or EGFR mutation. HPD is enriched in tumors with MDM2 amplification, EGFR mutations, and specific TP53 mutations. MDM2 amplification may create a tumor-intrinsic feedback: immune checkpoint blockade induces IFN-γ, which upregulates PD-L1 via JAK-STAT. In MDM2-amplified tumors, IFN-γ signaling may paradoxically activate MDM2 through an IRF-dependent mechanism, promoting p53 degradation and accelerating proliferation.

Verification: llm-judge
Cascade risk: Wrong mechanistic model → wrong patient selection strategy.

Data Provenance:

PDB 4ZQK: Queried 2026-02-17, resolution 2.45 Å, released 2015-11-04. Title: "Structure of the complex of human programmed death-1 (PD-1) and its ligand PD-L1."
ClinVar TP53: 1,705 pathogenic, 3,912 total variants; PTEN: 1,922 pathogenic variants (queried 2026-02-17 15:55 UTC)
Open Targets: TP53-hepatocellular carcinoma score 0.8001; TP53-neoplasm score 0.9363 (queried 2026-02-17)

Step 2 — Design discriminating experiment

File: chain17_step2.json

Question: Your top hypothesis is that PD-1 blockade activates Tregs more than effectors in HPD-prone tumors. Your secondary hypothesis is Fc-mediated effector T cell depletion. Design ONE experiment using patient samples (pre- and post-treatment biopsies) that distinguishes these two mechanisms. Specify: sample requirements, assays, controls, and the expected result pattern for each hypothesis.
Ideal answer: Experiment: Multi-parameter flow cytometry + spatial transcriptomics on matched pre/post-treatment biopsies

Samples: Pre-treatment biopsy (baseline) and on-treatment biopsy (cycle 2, day 1, ~3 weeks post-first dose) from: (a) 15 HPD patients, (b) 15 responders, (c) 15 progressive disease (non-HPD). All receiving anti-PD-1 monotherapy.

Panel 1 — Flow cytometry (dissociated tumor):

Treg panel: CD3/CD4/CD8/CD25/FoxP3/CTLA-4/Ki-67/PD-1
Effector panel: CD3/CD8/granzyme B/IFN-γ/PD-1/TIM-3/LAG-3/KLRG1
Absolute counts per gram of tumor (critical — ratios alone are insufficient)

Panel 2 — Spatial transcriptomics (10x Visium or MERFISH):

Map spatial distribution of Tregs (FOXP3+), CD8+ effectors (CD8A/GZMB), and macrophages (CD68/CD163) relative to tumor nests

Expected if H1 (Treg activation) is correct:

HPD post-treatment: ↑ absolute Treg count (>2-fold), ↑ Treg Ki-67+ (proliferating), ↑ Treg:CD8 ratio
Effector CD8+ count maintained or slightly increased but unchanged Ki-67/granzyme B (activated but suppressed)
Spatial: Tregs migrate INTO tumor nests post-treatment, surrounding CD8+ T cells
Responders: ↑ CD8+ count and Ki-67, Treg count stable or decreased

Expected if H2 (Fc-mediated CD8 depletion) is correct:

HPD post-treatment: ↓ absolute CD8+ T cell count (>50% reduction), especially PD-1hi effectors
Treg count unchanged or proportionally increased (because CD8+ depleted, ratio changes)
Spatial: CD8+ T cells depleted from tumor margins where they interface with FcR+ macrophages
Key discriminator: absolute CD8+ count. H1 predicts stable/increased CD8; H2 predicts decreased CD8.

Critical control: Include patients on anti-PD-1 with different Fc engineering (e.g., Fc-silent anti-PD-1 in clinical trials) — if HPD rate drops with Fc-silent antibodies, H2 is supported.

Verification: llm-judge
Cascade risk: Wrong experiment → can't distinguish mechanisms → wrong patient stratification.

Step 3 — Synthesize conclusion from results

File: chain17_step3.json

Question: Results from your study:

Metric (fold-change, post/pre)	HPD (n=15)	Responders (n=15)	PD non-HPD (n=15)
Absolute CD8+ count	1.4× (↑)	2.8× (↑)	1.1× (→)
CD8+ Ki-67+ (% of CD8)	8% → 22%	8% → 45%	8% → 12%
Absolute Treg count	3.2× (↑↑)	0.8× (→)	1.3× (↑)
Treg Ki-67+ (% of Tregs)	12% → 48%	12% → 15%	12% → 18%
Treg:CD8 ratio	0.3 → 0.7	0.3 → 0.1	0.3 → 0.35
Spatial: Tregs in tumor nests	Rare → abundant	Rare → rare	Rare → sparse

Which hypothesis is supported? What is the clinical implication for patient selection?

Ideal answer: H1 (Treg activation) is strongly supported; H2 (Fc-mediated CD8 depletion) is refuted.

Evidence:

CD8+ T cells are NOT depleted in HPD (1.4× increase, with modest Ki-67 activation at 22%), refuting H2's prediction of CD8 depletion.
Tregs are dramatically expanded in HPD (3.2× increase, Ki-67 from 12→48% = massive proliferation), with spatial invasion into tumor nests. This is precisely H1's prediction.
In responders, CD8+ cells expand 2.8× with robust activation (Ki-67 45%) while Tregs are stable — the effector:Treg balance shifts toward immunity.
The Treg:CD8 ratio is the key discriminator: HPD shifts from 0.3→0.7 (immunosuppressive); responders shift from 0.3→0.1 (immunocompetent).

Clinical implications:

Pre-treatment Treg:CD8 ratio as a predictive biomarker: Patients with high baseline Treg infiltration (>0.4 ratio) should be flagged as HPD risk. Consider combination with anti-CTLA-4 (which depletes Tregs via ADCC) before or concurrent with anti-PD-1.
Combination strategy for HPD-prone patients: Anti-PD-1 + ipilimumab (anti-CTLA-4, which depletes FoxP3+ Tregs through Fc-mediated ADCC) to counter Treg expansion. Alternative: anti-PD-1 + anti-CCR8 (selectively depletes intratumoral Tregs without systemic immune toxicity).
Early monitoring: Liquid biopsy or on-treatment biopsy at week 3 measuring Treg expansion could enable early detection and treatment switch before clinical HPD manifests.
Patient exclusion from anti-PD-1 monotherapy: Tumors with >50% FoxP3+ cells among CD4+ TILs should not receive anti-PD-1 alone.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 18: Structure to Drug (4 steps)

structure_to_drug — SARS-CoV-2 main protease inhibition by nirmatrelvir

Step 1 — Identify structural features

File: chain18_step1.json

Question: The crystal structure of SARS-CoV-2 main protease (Mpro, also called 3CLpro) in complex with nirmatrelvir (PF-07321332, the active component of Paxlovid) was determined at room temperature (PDB: 7SI9, resolution 2.0 Å). Mpro is a cysteine protease that cleaves the viral polyproteins pp1a and pp1ab at 11 sites, making it essential for viral replication. Identify the catalytic residues, describe the substrate-binding pocket architecture, and explain why Mpro is considered an excellent antiviral drug target.
Ideal answer: Mpro functions as a homodimer with each protomer containing three domains. The active site is located between domains I and II and contains the catalytic dyad: Cys145 (nucleophilic cysteine) and His41 (general base). Unlike serine proteases with a catalytic triad, Mpro uses a dyad mechanism where His41 activates Cys145 for nucleophilic attack on the substrate peptide bond.

The substrate-binding pocket has defined subsites: S1 pocket (deep, recognizes glutamine at P1 position — Mpro exclusively cleaves after Gln, which is unusual), S2 pocket (hydrophobic, accommodates Leu/Val at P2), S4 pocket (shallow, accepts small hydrophobic residues at P4), and S1' pocket (accommodates small residues at P1'). Nirmatrelvir mimics the peptide substrate: its pyrrolidinone occupies S1 (mimicking Gln), the dimethyl cyclopropyl group fills S2, and the trifluoroacetamide group occupies S4. Crucially, nirmatrelvir contains a nitrile warhead that forms a reversible covalent thioimidate bond with Cys145.

Why Mpro is an excellent target: (1) No human homolog — human cells have no cysteine protease with Gln specificity, enabling selectivity (ChEMBL CHEMBL4802135: Mpro IC50 = 0.79 nM, CHEMBL5112747, with minimal off-target activity). (2) Essential for replication — all 11 cleavage sites must be processed. (3) Conserved across coronaviruses — potential for pan-coronavirus inhibitors. (4) Structural conservation — the active site is under strong purifying selection, making resistance harder to develop.

Verification: llm-judge
Cascade risk: Wrong active site or pocket description → wrong SAR analysis.

Data Provenance:

PDB 7SI9: Queried 2026-02-17, resolution 2.0 Å, released 2021-10-20, X-ray. Title: "Room temperature X-ray structure of SARS-CoV-2 main protease (Mpro) in complex with PF-07321332"
ChEMBL CHEMBL4802135 (nirmatrelvir): IC50 = 0.79 nM (Mpro, CHEMBL5112747); IC50 = 75 nM (CHEMBL5106611); IC50 = 31 nM (CHEMBL5142713). Queried 2026-02-17.

Step 2 — Explain binding mechanism

File: chain18_step2.json

Question: Nirmatrelvir uses a nitrile warhead to form a reversible covalent bond with Cys145. Compare this to sotorasib's irreversible covalent bond with KRAS Cys12 (from Chain 11). Why was reversible covalent binding chosen for nirmatrelvir instead of irreversible? What are the pharmacological consequences of this design choice?
Ideal answer: Reversible vs. irreversible covalent: different targets, different strategies:

(1) Target biology dictates strategy:

KRAS G12C (sotorasib, irreversible): KRAS is a human protein mutated in cancer. The Cys12 is unique to the mutant — irreversible binding provides maximum target engagement and selectivity (WT KRAS has Gly12, no cysteine). Irreversible binding is acceptable because: (a) only tumor cells express the target, (b) sustained target engagement is desired (KRAS is long-lived, t½ ~24h), (c) no off-target cysteine reactivity concern at therapeutic doses.
Mpro (nirmatrelvir, reversible): Mpro is a viral protease in an acute infection. Cysteine proteases with active-site cysteines are common in human biology (cathepsins, caspases, deubiquitinases). An irreversible warhead risks cross-reactivity with human cysteine proteases, causing toxicity. Reversible binding provides: (a) selectivity via binding kinetics — the nitrile forms a stable but dissociable thioimidate, so selectivity comes from prolonged residence time in the specific Mpro pocket rather than permanent modification, (b) safety margin — if the compound dissociates from an off-target, no permanent damage occurs.

(2) Pharmacological consequences:

Nirmatrelvir requires sustained plasma concentrations above the IC50 because the drug-target complex is in dynamic equilibrium. This is why Paxlovid co-administers ritonavir (CYP3A4 inhibitor) to boost nirmatrelvir levels. Without boosting, nirmatrelvir's half-life (~5h) is insufficient for sustained target coverage.
Sotorasib's pharmacology is dose-schedule flexible — even if plasma levels drop, the drug remains bound to its target. Twice-daily dosing was later shown to be equally effective as once-daily, consistent with covalent pharmacology.

(3) Resistance implications:

Reversible inhibitors face easier resistance development — mutations that reduce binding affinity directly reduce efficacy. For nirmatrelvir, mutations at E166V and L167F in Mpro have been reported to reduce binding.
Irreversible inhibitors require mutations that eliminate the covalent residue (Cys→Ser/Ala), which may compromise protein function if the cysteine is essential.
Verification: llm-judge
Cascade risk: Wrong understanding of covalent pharmacology → wrong design strategy.

Data Provenance:

ChEMBL CHEMBL4535757 (sotorasib): IC50 = 68 nM KRAS G12C (CHEMBL4357259). ChEMBL CHEMBL4802135 (nirmatrelvir): IC50 = 0.79 nM Mpro (CHEMBL5112747). Queried 2026-02-17.
PDB 7SI9: resolution 2.0 Å, PDB 6OIM: resolution 1.65 Å. Both queried 2026-02-17.

Step 3 — SAR prediction

File: chain18_step3.json

Question: Mpro resistance mutations are emerging. The E166V mutation in Mpro reduces nirmatrelvir IC50 from ~1 nM to ~50-100 nM but also reduces viral fitness (Mpro catalytic efficiency drops ~3-fold). Which of the following drug design strategies would BEST address nirmatrelvir resistance while maintaining pan-coronavirus potential? A) Increase the reactivity of the nitrile warhead to form a more stable covalent bond B) Design a non-covalent inhibitor with extended interactions into the S3/S4 pockets that are distal from position 166 C) Develop a PROTAC that recruits a human E3 ligase to degrade Mpro — since Mpro is a viral protein, any ubiquitination would be productive D) Switch to an allosteric inhibitor targeting the Mpro dimer interface
Ideal answer: B. Non-covalent inhibitors with extended S3/S4 pocket interactions overcome E166V by: (1) distributing binding energy across multiple subsites so that a single mutation at position 166 causes only a modest affinity loss, and (2) the S3/S4 pockets are more conserved across coronaviruses (they contact the peptide backbone, not sidechain-specific residues), maintaining pan-coronavirus potential. (A) is wrong — increasing warhead reactivity would increase off-target cysteine labeling (toxicity) without specifically addressing the E166V mutation, which affects the S1 pocket shape rather than Cys145 reactivity. (C) is creative but impractical — PROTACs require cell-penetrating molecules with drug-like properties; current PROTACs are large (MW >800) and poorly bioavailable orally. Mpro is also produced continuously during viral replication, so degradation must outpace synthesis. (D) is theoretically interesting but the dimer interface is flat and large (~1,600 Å²), making it a challenging drug target with no validated precedent for viral proteases.
Verification: programmatic (multiple_choice: B)
Cascade risk: Wrong SAR reasoning → wrong development strategy.

Step 4 — Experimental validation plan

File: chain18_step4.json

Question: Design a preclinical evaluation plan for a next-generation Mpro inhibitor (Compound Y, non-covalent, extended S3/S4 binding) against both wild-type and E166V Mpro. Include resistance profiling, antiviral efficacy, and a key pharmacological challenge specific to oral antivirals.
Ideal answer: (1) Biochemical potency against mutant panel: FRET-based Mpro enzymatic assay against WT, E166V, L167F, E166V/L167F double mutant, and SARS-CoV-1 Mpro (pan-CoV assessment). Success: Ki <10 nM for WT, <50 nM for single mutants, <200 nM for double. Cross-reactivity with human cathepsin L, caspase-3, and SARS-CoV-2 PLpro <1 µM (selectivity window >100×). (2) Cellular antiviral assay: CPE assay in Vero E6-TMPRSS2 cells with WT SARS-CoV-2 and reverse-genetics E166V mutant virus. EC50 measurement with CC50 for selectivity index (SI). Success: EC50 <100 nM, SI >100. (3) Resistance profiling: Serial passage of SARS-CoV-2 in VeroE6 cells with escalating Compound Y concentrations (starting at 0.5× EC50, doubling every 3 passages, 20 passages total). WGS of resistant viruses at passages 10, 15, 20. Compare mutation spectrum to nirmatrelvir-selected resistance. Success: >15 passages to achieve >10× EC50 shift (vs. ~8 passages for nirmatrelvir). (4) PK challenge — oral bioavailability without boosting: Nirmatrelvir requires ritonavir boosting (CYP3A4 inhibition) which causes extensive drug-drug interactions. Compound Y must achieve oral bioavailability >30% without a booster. Rat PK study: IV (1 mg/kg) and PO (10 mg/kg), measure Cmax, AUC, t½, F. Design Compound Y to avoid CYP3A4 as primary clearance route (assess metabolic soft spots by liver microsome stability across species). Success: F >30%, t½ >4h, allowing BID or TID dosing without ritonavir.
Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

ChEMBL CHEMBL4802135 (nirmatrelvir): multiple IC50 values (0.79-145 nM range across assays). Queried 2026-02-17.
PDB 7SI9: Mpro + nirmatrelvir, 2.0 Å. PDB 8DCZ: Mpro M165Y mutant + nirmatrelvir, 2.38 Å. Queried 2026-02-17.

Chain 19: Data to Mechanism (3 steps)

data_to_mechanism — Imatinib resistance in CML: BCR-ABL T315I gatekeeper mutation

Step 1 — Interpret ambiguous data

File: chain19_step1.json

Question: A CML patient in chronic phase responds to imatinib (400 mg QD) with complete hematologic response at 3 months and complete cytogenetic response at 12 months. At 24 months, BCR-ABL transcript levels (measured by qPCR, international scale) begin rising: 0.01% IS at 12 months → 0.1% at 18 months → 1.2% at 24 months → 5.8% at 30 months. Bone marrow cytogenetics at 30 months shows 35% Philadelphia-chromosome positive metaphases. Imatinib trough level is 1,200 ng/mL (therapeutic range 1,000-3,000 ng/mL). ChEMBL data shows imatinib IC50 = 40 nM against ABL1 (CHEMBL846551), 240 nM against PDGFRβ (CHEMBL763440), and 260 nM against KIT (CHEMBL766073). The crystal structure of ABL kinase with imatinib (PDB: 1IEP, resolution 2.1 Å; also PDB: 2HYY, 2.4 Å) shows imatinib binding in the DFG-out inactive conformation. List the 3 most likely causes of this rising BCR-ABL, ranked by probability.
Ideal answer: 1. (Most likely) Acquired BCR-ABL kinase domain mutation: The kinetic pattern — initial excellent response followed by gradual molecular relapse while maintaining therapeutic drug levels — is classic for emergence of a resistant clone. The most common mutations are: T315I (gatekeeper, ~15% of resistant cases), Y253H, E255K/V, F359V. T315I is the most clinically significant because it confers resistance to all first- and second-generation TKIs except ponatinib. The threonine-to-isoleucine substitution at the gatekeeper position eliminates a critical hydrogen bond between T315's hydroxyl and imatinib's aminopyrimidine, while the bulky isoleucine creates steric clash in the binding pocket.

2. (Possible) BCR-ABL amplification/overexpression: Increased BCR-ABL copy number (by gene amplification or isodicentric Philadelphia chromosome) can overwhelm imatinib binding capacity. Even at therapeutic levels, if BCR-ABL protein exceeds the drug's stoichiometric capacity, kinase activity resumes. Distinguishable from point mutations by FISH (multiple BCR-ABL signals) or by mutation screening showing WT sequence.

3. (Less likely given trough levels) Non-compliance or drug interaction: Although trough is 1,200 ng/mL (in range), this is a single measurement. Intermittent non-compliance or new medications inducing CYP3A4 (rifampin, St. John's wort, phenytoin) could cause periodic subtherapeutic levels allowing clonal expansion. However, the trough level argues against this.

Recommended next step: ABL1 kinase domain mutation analysis by Sanger sequencing or next-generation sequencing (NGS with >1% sensitivity threshold).

Verification: llm-judge
Cascade risk: Wrong diagnosis → wrong second-line therapy selection.

Data Provenance:

PDB 1IEP: Queried 2026-02-17, resolution 2.1 Å, released 2001-04-18. Title: "Crystal structure of the c-Abl kinase domain in complex with STI-571."
PDB 2HYY: resolution 2.4 Å, released 2007-01-16. Title: "Human Abl kinase domain in complex with imatinib."
ChEMBL CHEMBL941 (imatinib): IC50 = 40 nM ABL1 (CHEMBL846551), 240 nM PDGFRβ (CHEMBL763440), 260 nM KIT (CHEMBL766073), max_phase = 4. Queried 2026-02-17.
ClinVar ABL1: 94 pathogenic variants (queried 2026-02-17)
UniProt P00533 (EGFR): kinase domain 712-979. For comparison with ABL gatekeeper mechanism.

Step 2 — Update with new evidence

File: chain19_step2.json

Question: ABL1 kinase domain sequencing reveals the T315I mutation at 45% variant allele frequency. You switch the patient to dasatinib (100 mg QD, a second-generation TKI). After 6 months on dasatinib: BCR-ABL = 12% IS (worse than at switch). Dasatinib trough is adequate. The ponatinib IC50 against ABL1 T315I is 8.6 nM (ChEMBL CHEMBL1176860), while ponatinib IC50 against WT ABL1 is 40 nM (CHEMBL1176861). (a) Why did dasatinib fail? (b) What is the recommended next therapy? (c) Calculate the ponatinib selectivity for T315I vs. WT ABL1 and explain why this ratio is unusual.
Ideal answer: (a) Dasatinib failure: T315I confers resistance to dasatinib because, like imatinib, dasatinib forms a hydrogen bond with T315 (via the hydroxyl group). The isoleucine substitution eliminates this interaction and creates steric clash. This is why T315I is called the "gatekeeper" mutation — it guards the entrance to the hydrophobic back pocket used by type I (dasatinib, bosutinib) and type II (imatinib, nilotinib) inhibitors.

(b) Recommended therapy: Ponatinib (Iclusig) — a third-generation TKI specifically designed to accommodate the T315I isoleucine through a rigid ethynyl linker that positions the inhibitor to avoid steric clash with isoleucine. Alternatively, asciminib (ABL001), a first-in-class STAMP (Specifically Targeting the ABL Myristoyl Pocket) inhibitor that binds the allosteric myristoyl pocket rather than the ATP site — completely bypassing the ATP-site gatekeeper mutation. For the patient's situation (T315I with rising BCR-ABL on dasatinib), guidelines recommend ponatinib 45 mg QD with dose reduction after response, or asciminib 200 mg BID.

(c) Ponatinib selectivity: IC50(WT)/IC50(T315I) = 40/8.6 = 4.6-fold more potent against T315I than WT. This is unusual because most kinase inhibitors lose potency against gatekeeper mutations (5-100× IC50 increase). Ponatinib is actually more potent against the mutant. Explanation: Ponatinib was computationally designed to exploit the T315I mutation — the isoleucine creates a deeper hydrophobic pocket that the ethynyl group fills more optimally than the smaller threonine hydroxyl. However, this selectivity means ponatinib at WT-ABL-effective doses also potently inhibits other kinases (FGFR, VEGFR, PDGFRα), contributing to its vascular toxicity (arterial occlusive events).

Verification: llm-judge
Cascade risk: Wrong TKI selection → progressive disease → blast crisis.

Data Provenance:

ChEMBL CHEMBL1171837 (ponatinib): IC50 = 8.6 nM ABL1 (CHEMBL1176860), 40 nM ABL1 (CHEMBL1176861), max_phase = 4. BaF3 BCR-ABL IC50 = 1.2 nM (CHEMBL1176862), BaF3 BCR-ABL T315I IC50 = 8.8 nM (CHEMBL1176863). Queried 2026-02-17.
Clinical trial NCT04626024: TKI cessation for CML, Phase II, RECRUITING (queried 2026-02-17)

Step 3 — Correct prior analysis

File: chain19_step3.json

Question: The patient achieves complete molecular response on ponatinib after 12 months (BCR-ABL <0.01% IS). However, they develop hypertension (BP 165/95) and elevated troponin-I (0.08 ng/mL, upper normal 0.04). Ponatinib carries a FDA black box warning for arterial occlusive events (AOEs), occurring in ~25% of patients at 45 mg. (a) What is the mechanism of ponatinib cardiovascular toxicity? (b) Should you stop ponatinib? (c) Propose an evidence-based management strategy that balances CML control with cardiovascular risk.
Ideal answer: (a) Mechanism: Ponatinib inhibits VEGFR2 (IC50 ~1.5 nM) and FGFR1 (IC50 ~2 nM) — both are essential for vascular endothelial survival and nitric oxide production. VEGFR2 inhibition reduces NO synthesis → endothelial dysfunction → vasoconstriction → hypertension. FGFR inhibition impairs endothelial repair after microinjury. Combined with PDGFRα/β inhibition (impaired pericyte function), this creates a prothrombotic endothelium. The elevated troponin suggests early myocardial injury, possibly from coronary microvascular dysfunction or demand ischemia secondary to hypertension.

(b) Do NOT stop ponatinib abruptly — the patient has a dangerous T315I mutation that was resistant to two prior TKIs. Stopping risks rapid molecular relapse → hematologic relapse → potential blast crisis within months. This is a classic risk-risk decision, not a risk-benefit one.

(c) Management strategy:

Dose reduce ponatinib from 45 mg to 15 mg QD. The OPTIC trial demonstrated that once BCR-ABL ≤1% IS is achieved, dose reduction to 15 mg maintains molecular response in >90% of patients while reducing AOE risk from ~25% to ~5%.
Aggressive cardiovascular risk management: Start amlodipine 10 mg + lisinopril 20 mg for BP target <130/80. Aspirin 81 mg daily (if platelets adequate). Statin for endothelial protection regardless of LDL.
Serial monitoring: Troponin-I monthly × 3 then quarterly. If troponin continues to rise on 15 mg, consider switch to asciminib (allosteric, does not inhibit VEGFR/FGFR — no cardiovascular signal in trials). Asciminib 200 mg BID for T315I.
Echocardiography at baseline and every 6 months.
Maintain BCR-ABL monitoring monthly — if molecular response is lost on 15 mg, the decision is harder (escalate ponatinib with cardiology co-management vs. switch to asciminib).

Verification: llm-judge
Cascade risk: Terminal step — tests integration of pharmacology, clinical medicine, and risk management.

Chain 20: Evidence Synthesis (3 steps)

evidence_synthesis — FLT3 inhibitors in AML: gilteritinib vs. midostaurin

Step 1 — Compare conflicting papers

File: chain20_step1.json

Question: Two pivotal trials established FLT3 inhibitors in AML treatment:

RATIFY (New England Journal of Medicine, 2017): Midostaurin + standard chemotherapy (7+3) vs. placebo + chemo in newly diagnosed FLT3-mutated AML. n=717. Median OS: 74.7 months (midostaurin) vs. 25.6 months (placebo). HR=0.78, p=0.009.

ADMIRAL (New England Journal of Medicine, 2019): Gilteritinib monotherapy vs. salvage chemotherapy in relapsed/refractory FLT3-mutated AML. n=371. Median OS: 9.3 months (gilteritinib) vs. 5.6 months (chemo). HR=0.64, p<0.001.

ChEMBL data shows gilteritinib IC50 = 0.41 nM against FLT3 (CHEMBL3706339) vs. midostaurin IC50 ~10-500 nM (a multi-kinase inhibitor). FLT3 is the third-ranked target for AML in Open Targets (score 0.8219). ClinVar lists 50 pathogenic FLT3 variants. PDB: 6JQR shows FLT3 bound to gilteritinib (resolution 2.2 Å, released 2019). Can you conclude that gilteritinib is the superior FLT3 inhibitor based on these trials?

Ideal answer: No — these trials answer different clinical questions and cannot be directly compared:

Different disease settings: RATIFY tested front-line combination (midostaurin + chemo); ADMIRAL tested single-agent gilteritinib in relapsed/refractory disease. Comparing OS across disease settings is like comparing survival in localized vs. metastatic cancer — the denominators are fundamentally different.
Different comparators: RATIFY's control arm included standard chemotherapy (which alone has ~40% long-term survival). ADMIRAL's control arm was salvage chemotherapy (historically <10% long-term survival). The absolute survival benefit is much smaller in RATIFY (improvement over an already effective backbone) but impacts a much larger proportion of patients.
Different FLT3 mutation types: Both trials included FLT3-ITD and TKD mutations, but the relative proportions and prognostic impact differ. FLT3-ITD with high allelic ratio has particularly poor prognosis — the distribution of this subtype across trials affects outcomes.
Gilteritinib IS more FLT3-selective: IC50 = 0.41 nM (FLT3) vs. midostaurin which is a multi-kinase inhibitor with modest FLT3 potency. However, midostaurin's multi-kinase activity (PKC, VEGFR, KIT, PDGFR) may contribute to its efficacy through non-FLT3 mechanisms, especially in combination with chemotherapy.
The correct comparison: To determine if gilteritinib is superior to midostaurin in the front-line setting, you need the ongoing QuANTUM-First or HOVON 156 trials testing gilteritinib + chemo vs. midostaurin + chemo head-to-head.

Verification: llm-judge
Cascade risk: Inappropriate cross-trial comparison → wrong treatment algorithm.

Data Provenance:

PDB 6JQR: Queried 2026-02-17, resolution 2.2 Å, released 2019-11-20. Title: "Crystal structure of FLT3 in complex with gilteritinib"
ChEMBL CHEMBL3301622 (gilteritinib): FLT3 IC50 = 0.41 nM (CHEMBL3706339), AXL IC50 = 1.0 nM (CHEMBL3811320), ALK IC50 = 1.5 nM (CHEMBL3706338), max_phase = 4. Queried 2026-02-17.
UniProt P36888 (FLT3): 993 aa. Domains: Ig-like C2-type (253-343), Protein kinase (610-943), Active site at 811. Queried 2026-02-17.
ClinVar FLT3: 50 pathogenic variants (queried 2026-02-17)
Open Targets AML: CEBPA 0.8444, DNMT3A 0.8296, FLT3 0.8219 (queried 2026-02-17)

Step 2 — Meta-analytic reasoning

File: chain20_step2.json

Question: Additional data is now available on FLT3 inhibitors in AML:

Trial	Drug	Setting	N	Median OS (drug)	Median OS (control)	HR
RATIFY	Midostaurin + chemo	Front-line	717	74.7 mo	25.6 mo	0.78
ADMIRAL	Gilteritinib mono	R/R	371	9.3 mo	5.6 mo	0.64
QuANTUM-First	Quizartinib + chemo	Front-line	539	31.9 mo	15.1 mo	0.78
LACEWING	Gilteritinib + azacitidine	Unfit elderly	123	9.82 mo	8.87 mo	0.916

(a) What pattern emerges across these four trials? (b) Why did the LACEWING trial fail while RATIFY and QuANTUM-First succeeded? (c) How would you formally assess whether FLT3 inhibitor efficacy depends on the backbone chemotherapy intensity?

Ideal answer: (a) Pattern: FLT3 inhibitors provide clear benefit when combined with intensive chemotherapy (HR 0.78 in both RATIFY and QuANTUM-First), moderate benefit as monotherapy vs. salvage chemo (HR 0.64 in ADMIRAL), but minimal benefit with low-intensity backbone (HR 0.916 in LACEWING). This suggests FLT3 inhibitors amplify the effect of cytotoxic chemotherapy rather than being sufficient as single pathway-targeted agents.

(b) LACEWING failure: Several factors: (1) The elderly unfit population has AML with different biology — more adverse cytogenetics, more secondary AML, more co-mutations (DNMT3A, TET2, ASXL1) that drive chemoresistance independent of FLT3. (2) Azacitidine is a low-intensity agent that induces differentiation/apoptosis through epigenetic mechanisms — it may not synergize with FLT3 inhibition the same way cytotoxic 7+3 does. (3) FLT3 mutation is a proliferative driver; cytotoxic chemotherapy attacks the proliferating population and FLT3 inhibitors prevent regrowth — this synergy requires the chemotherapy to generate a significant cell kill, which azacitidine doesn't achieve. (4) Small sample size (n=123) limited power to detect modest benefits.

(c) Formal analysis approach:

Meta-regression: Random-effects meta-analysis with log(HR) as the outcome and backbone intensity (intensive chemo, low-intensity, monotherapy) as a categorical moderator variable. Test whether the moderator explains heterogeneity in treatment effect.
If only 4 studies are available, this is underpowered for formal meta-regression (k<10 rule). Instead: (1) present a forest plot stratified by backbone intensity with subgroup interaction test, (2) use individual patient data (IPD) meta-analysis if available — model OS with treatment × backbone interaction term in a Cox model.
The hypothesis predicts: intensive chemo backbone → HR ~0.75-0.80; low-intensity backbone → HR ~0.90-1.0; monotherapy → intermediate (HR ~0.65 but in a population with much shorter survival).
Verification: llm-judge
Cascade risk: Wrong pattern identification → wrong treatment algorithm for elderly patients.

Step 3 — Clinical recommendation

File: chain20_step3.json

Question: Based on your synthesis — FLT3 inhibitors work best with intensive chemotherapy, modestly as monotherapy in R/R, and poorly with low-intensity backbones — a tumor board asks: A 72-year-old patient with newly diagnosed FLT3-ITD+ AML (allelic ratio 0.8, NPM1 co-mutation, no adverse cytogenetics) with ECOG PS 1, creatinine 1.4, ejection fraction 50%. Is this patient fit for intensive chemotherapy + FLT3 inhibitor, or should they receive a low-intensity regimen? What FLT3 inhibitor would you recommend and why?
Ideal answer: Assessment: This patient is in the "gray zone" — potentially fit for intensive therapy with careful evaluation.

Favorable factors: ECOG 1, NPM1 co-mutation (favorable prognosis), no adverse cytogenetics. NPM1+/FLT3-ITD+ with allelic ratio <0.5 is favorable risk; allelic ratio 0.8 shifts to intermediate risk (ELN 2022). Age 72 alone does not preclude intensive therapy.

Concerning factors: Age 72 increases treatment-related mortality (TRM) with 7+3 (~10-15% vs. ~5% in younger patients). Creatinine 1.4 suggests mild renal impairment (estimate GFR). EF 50% is borderline for anthracycline use (daunorubicin in 7+3).

Recommendation:

Geriatric assessment (gait speed, ADLs, Charlson comorbidity index) should guide fitness determination, not age alone.
If deemed fit: 7+3 + midostaurin (RATIFY-based, FDA-approved front-line) or 7+3 + quizartinib (QuANTUM-First, recently approved, more FLT3-selective). Between these: quizartinib is preferred because (a) it has higher FLT3 selectivity, (b) it demonstrated improvement in both FLT3-ITD and high allelic ratio subgroups, (c) the survival benefit was clear even in older patients (60-75 subgroup analysis).
Consider dose-reduced 7+3 ("5+2") to mitigate anthracycline cardiac risk given EF 50%.
If deemed unfit by geriatric assessment: Venetoclax + azacitidine (standard of care for unfit AML) + consider adding gilteritinib — although LACEWING was negative, venetoclax-based combinations have different synergy biology than azacitidine alone, and ongoing trials are exploring this.
Plan for maintenance FLT3 inhibitor after remission — RATIFY showed most benefit was in the maintenance phase.
Molecular monitoring: PCR-based FLT3-ITD and NPM1 MRD at cycles 2, 4, and post-consolidation. If MRD-negative for NPM1, excellent prognosis. If MRD-positive, consider allogeneic transplant if fit.

Do NOT give: Gilteritinib monotherapy front-line — LACEWING's failure applies even more strongly to monotherapy; reserve gilteritinib for R/R setting where ADMIRAL demonstrated benefit.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

PDB 6JQR: FLT3 + gilteritinib, 2.2 Å, 2019. Queried 2026-02-17.
ChEMBL CHEMBL3301622 (gilteritinib): FLT3 IC50 = 0.41 nM (CHEMBL3706339). ChEMBL CHEMBL941 (imatinib for comparison): ABL1 IC50 = 40 nM. Queried 2026-02-17.
ChEMBL CHEMBL1171837 (ponatinib): ABL1 IC50 = 8.6 nM (CHEMBL1176860). Queried 2026-02-17.
ClinVar FLT3: 50 pathogenic; DNMT3A: 352 pathogenic; NPM1: 29 pathogenic (queried 2026-02-17)
Open Targets AML: FLT3 0.8219, DNMT3A 0.8296, CEBPA 0.8444 (queried 2026-02-17)
Clinical trial NCT05193448: Gilteritinib real-world, COMPLETED. NCT03839771: Enasidenib/Ivosidenib + chemo, Phase III, ACTIVE_NOT_RECRUITING (queried 2026-02-17)

Chain 21: Genetics to Therapy (3 steps)

genetics_to_therapy — SCN1A loss-of-function in Dravet syndrome

Step 1 — Gene function and disease mechanism

File: chain21_step1.json

Question: Dravet syndrome is a severe epileptic encephalopathy caused by heterozygous loss-of-function mutations in SCN1A, encoding the Nav1.1 voltage-gated sodium channel. The cryo-EM structure of Nav1.1 with beta4 subunit (PDB: 7DTD, resolution 3.3 Å) shows the channel architecture. UniProt P35498 lists SCN1A as 2,009 amino acids with an IQ domain (residues 1915-1944). ClinVar reports 2,858 pathogenic SCN1A variants out of 5,158 total. Why does LOSS of function of a sodium channel cause GAIN of neuronal excitability (seizures)? This seems paradoxical — explain the cell-type-specific mechanism.
Ideal answer: This is one of the most important paradoxes in epilepsy genetics. The resolution lies in cell-type-specific expression:

Nav1.1 (SCN1A) is preferentially expressed in GABAergic inhibitory interneurons, particularly parvalbumin-positive (PV+) fast-spiking interneurons in the cortex and hippocampus. These interneurons fire at very high frequencies (up to 200-300 Hz) and require robust sodium currents for sustained rapid firing. They provide critical feedforward and feedback inhibition to excitatory pyramidal neurons, maintaining the excitation-inhibition (E/I) balance.

Loss-of-function mechanism in Dravet:

SCN1A haploinsufficiency (50% reduction in Nav1.1) reduces sodium current density in PV+ interneurons
Interneurons cannot sustain high-frequency firing → reduced GABA release
Pyramidal neurons, which primarily use Nav1.2 and Nav1.6 (both intact), maintain normal excitability
The E/I balance shifts toward excitation → seizures, cognitive impairment

Why this explains the clinical phenotype: Onset is typically at 6-12 months (when Nav1.1 replaces Nav1.3 as the dominant interneuron sodium channel during development). Fever-triggered seizures occur because temperature-dependent channel kinetics are more disrupted in haploinsufficient interneurons. Status epilepticus risk is high because once interneuron firing fails, there is no brake on excitatory network activity.

Critical therapeutic implication: Traditional sodium channel blockers (carbamazepine, phenytoin) — which are first-line for many epilepsies — are CONTRAINDICATED in Dravet because they further reduce the already-compromised Nav1.1 function, worsening seizures. Treatment must avoid sodium channel blockade and instead enhance GABAergic function or reduce excitation through other mechanisms.

Verification: llm-judge
Cascade risk: Wrong cell-type mechanism → wrong drug selection → patient harm.

Data Provenance:

PDB 7DTD: Queried 2026-02-17, resolution 3.3 Å, released 2021-04-07, cryo-EM. Title: "Voltage-gated sodium channel Nav1.1 and beta4"
UniProt P35498 (SCN1A): 2,009 aa, IQ domain (1915-1944). Queried 2026-02-17.
ClinVar SCN1A: 2,858 pathogenic variants, 5,158 total (queried 2026-02-17 15:55 UTC)
Clinical trial NCT06598449: Fenfluramine in children with Dravet, Phase IV, RECRUITING (queried 2026-02-17)

Step 2 — Structural consequence of mutation

File: chain21_step2.json

Question: A Dravet patient has the de novo missense mutation SCN1A R1648H (in the S4 voltage-sensing segment of domain IV). S4 segments contain positively charged arginine/lysine residues at every third position that act as voltage sensors — they move outward in response to depolarization, initiating channel opening (activation). Predict the biophysical consequence of R1648H on channel gating, explain how this leads to loss of function in the context of fast-spiking interneurons, and propose how to experimentally validate this using patch-clamp electrophysiology.
Ideal answer: Predicted biophysical consequence: R1648H neutralizes a positive charge in the DIV S4 voltage sensor (arginine → histidine, which is mostly uncharged at physiological pH). This will: (1) Shift the voltage-dependence of inactivation — DIV S4 movement is specifically coupled to fast inactivation (not activation). Neutralizing a charge reduces the voltage sensitivity of DIV S4, causing: (a) accelerated entry into inactivation (faster inactivation kinetics), and (b) hyperpolarized shift in the voltage-dependence of steady-state inactivation (V½ inactivation shifts negative by ~10-15 mV). (2) Slowed recovery from inactivation — the channel stays inactivated longer between action potentials.

Impact on fast-spiking interneurons: PV+ interneurons fire at 200+ Hz, with ~3-5 ms between action potentials. At each spike, Nav1.1 channels must: activate → inactivate → recover from inactivation → be available for the next spike. If recovery from inactivation is slowed (due to R1648H), channels accumulate in the inactivated state during high-frequency firing. After 10-20 spikes, insufficient channels are available → depolarization block → interneuron falls silent. Pyramidal neurons firing at <50 Hz are minimally affected because they have much longer inter-spike intervals for recovery.

Experimental validation:

Heterologous expression: Transfect HEK293T with WT or R1648H Nav1.1 (+ β1 subunit). Whole-cell voltage-clamp at 22°C.
Steady-state inactivation: Step to conditioning potentials (-120 to -20 mV, 500 ms) then test pulse to 0 mV. Fit Boltzmann. Predict: WT V½ ≈ -65 mV; R1648H V½ ≈ -78 mV (negative shift).
Recovery from inactivation: Two-pulse protocol: 500 ms at 0 mV (inactivate) → variable recovery interval at -80 mV (1-100 ms) → test pulse. Predict: WT τ_recovery ≈ 5 ms; R1648H ≈ 12 ms.
High-frequency train: Inject a train of 200 brief current pulses at 200 Hz in current-clamp (or in iPSC-derived interneurons expressing R1648H). Predict: WT maintains firing throughout; R1648H shows progressive amplitude reduction and depolarization block after ~15 spikes.

Verification: llm-judge
Cascade risk: Wrong biophysical prediction → wrong therapeutic rationale.

Step 3 — Therapeutic strategy

File: chain21_step3.json

Question: Given that Dravet syndrome involves interneuron-specific Nav1.1 loss-of-function, propose two therapeutic strategies: one currently approved and one in development. For each, explain the mechanism, key evidence, and a limitation.
Ideal answer: Strategy 1 — Approved: Fenfluramine (Fintepla) Mechanism: Fenfluramine acts through two complementary mechanisms: (1) It releases serotonin (5-HT) from presynaptic vesicles and inhibits reuptake, increasing 5-HT levels. 5-HT activates 5-HT2C receptors on GABAergic interneurons, enhancing their excitability — partially compensating for the Nav1.1 deficit by depolarizing interneurons through a non-sodium-channel mechanism. (2) It also has direct positive modulation of sigma-1 receptors, which may have independent anti-seizure effects. Evidence: Phase III trial (NCT03936777) showed 62% median seizure frequency reduction vs. 1% placebo. FDA-approved 2020 for Dravet (age ≥2 years). Some patients achieve >75% seizure reduction. Limitation: (1) Historical association with cardiac valvulopathy (at higher doses for obesity treatment) requires echocardiographic monitoring every 6 months, adding burden and cost. (2) Does not address the underlying Nav1.1 deficiency — it's a compensatory mechanism that may lose efficacy if interneurons degenerate over time. (3) ~30% of patients are non-responders.

Strategy 2 — In development: SCN1A antisense oligonucleotide (TANGO approach) Mechanism: Targeted Augmentation of Nuclear Gene Output (TANGO). SCN1A has a naturally occurring non-productive splice variant (NMD-inducing poison exon). An antisense oligonucleotide (ASO) blocks inclusion of this poison exon, increasing productive SCN1A mRNA and Nav1.1 protein from the wild-type allele. This directly addresses haploinsufficiency by upregulating the functional allele from ~50% to potentially ~75-100% of normal. Evidence: Preclinical data in Scn1a+/- mice shows increased Nav1.1 protein and reduced seizure susceptibility. STK-001 (Stoke Therapeutics) is in Phase I/II clinical trials. This approach is mutation-agnostic — works for any heterozygous loss-of-function SCN1A mutation (>80% of Dravet patients). Limitation: (1) Requires intrathecal injection (IT) every few months — invasive, especially for young children. (2) Distribution of ASOs throughout the CNS is uneven — brainstem and spinal cord are well-penetrated, but cortical delivery may be insufficient. (3) Risk of increasing Nav1.1 in excitatory neurons (where it's normally low) could theoretically have paradoxical effects, though preclinical data suggests this is not a major issue. (4) Long-term safety of chronic IT ASO administration in children is unknown.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

Clinical trial NCT06598449: Fenfluramine Phase IV, RECRUITING (queried 2026-02-17)
Clinical trial NCT03936777: Fenfluramine Phase III in Dravet, COMPLETED (queried 2026-02-17)
Clinical trial NCT03467113: ZX008 (fenfluramine) Phase I, COMPLETED (queried 2026-02-17)
ClinVar SCN1A: 2,858 pathogenic / 5,158 total (queried 2026-02-17)
PDB 7DTD: Nav1.1+β4, 3.3 Å, cryo-EM, 2021 (queried 2026-02-17)

Chain 22: Protocol Troubleshoot (3 steps)

protocol_troubleshoot — CRISPR base editing efficiency in primary T cells

Step 1 — Diagnose protocol error

File: chain22_step1.json

Question: You are using an adenine base editor (ABE8e) to install a clinically relevant A-to-G edit in primary human CD4+ T cells for a cell therapy application. Your protocol: isolate CD4+ T cells from PBMCs (negative selection), activate with anti-CD3/CD28 Dynabeads (48h), electroporate ABE8e mRNA (1 µg) + synthetic sgRNA (3 µg) using a Lonza 4D-Nucleofector (program EO-115), culture in complete RPMI + IL-2 (30 U/mL) for 5 days, harvest and assess editing by Sanger sequencing + EditR/ICE analysis. Result: Sanger sequencing shows only 8% A-to-G editing at the target adenine (expected: >60% for ABE8e in this cell type). Cell viability post-electroporation is 72% (acceptable). The sgRNA was validated in HEK293T cells with 78% editing. What are the most likely causes of low editing in primary T cells?
Ideal answer: Several factors likely contribute, ranked by impact:

1. (Most likely) T cell activation state and cell cycle: ABE8e functions optimally in actively dividing cells because base editing requires DNA replication for permanent incorporation of the edit. Although you activated with CD3/CD28 beads for 48h, peak T cell division occurs 48-72h post-activation. Electroporating at exactly 48h means many cells haven't entered S phase yet. Additionally, 48h of activation may be insufficient for some T cell subsets (especially memory T cells) to fully enter cell cycle. Fix: Electroporate at 72h post-activation when >80% of cells are in active division (confirm by Ki-67 staining or CFSE dilution).

2. mRNA degradation and expression kinetics: ABE8e mRNA must be translated, folded, and form a complex with sgRNA intracellularly. In primary T cells (which have robust innate immune sensors), unmodified mRNA triggers TLR7/8 and RIG-I, leading to: (a) IFN-I response that inhibits translation, (b) rapid mRNA degradation. Fix: Use N1-methylpseudouridine-modified mRNA and ensure 5'-cap (CleanCap) to minimize innate immune activation.

3. sgRNA design and modification: In primary T cells, unmodified sgRNA is rapidly degraded by RNases. Fix: Use chemically modified sgRNA with 2'-O-methyl and phosphorothioate linkages at both 3' and 5' ends (standard for Synthego/IDT synthetic guides). If you used in vitro transcribed sgRNA, this is likely a major issue.

4. Electroporation parameters: EO-115 is a standard T cell program, but cell density matters. If too many cells were electroporated (>2×10⁶ per 20 µL cuvette), field distribution is uneven. ABE8e mRNA (large, ~5 kb) requires efficient delivery. Fix: Optimize cell density to 1×10⁶ cells/reaction, consider increasing mRNA to 2-3 µg.

5. Editing window mismatch: ABE8e has a narrow editing window (positions 3-9 of the protospacer, counting from the PAM-distal end). If the target adenine is outside this window, editing will be low regardless of delivery. Verify the target A is within the editing window.

Verification: llm-judge
Cascade risk: Wrong diagnosis → continued low editing → failed cell therapy manufacturing.

Step 2 — Interpret corrected result

File: chain22_step2.json

Question: After optimization (72h activation, modified mRNA 2 µg, chemically modified sgRNA, 1×10⁶ cells per reaction), your new results show 62% A-to-G editing at the target position (A6 of protospacer). However, amplicon deep sequencing reveals: (a) Target A6: 62% A-to-G (desired edit), (b) Bystander A4: 28% A-to-G (unintended), (c) Bystander A8: 15% A-to-G (unintended). The bystander edits at A4 and A8 result in amino acid changes — A4 edit causes a synonymous mutation (silent), but the A8 edit causes a missense change (Thr→Ala) in a conserved residue. How do you assess the significance of these bystander edits for clinical translation?
Ideal answer: Assessment by bystander position:

A4 (28% editing, synonymous): Low clinical concern. The synonymous change doesn't alter the protein sequence. However: (1) verify it doesn't affect mRNA splicing (check for ESE/ESS disruption using ESEfinder), (2) it changes the DNA sequence which could theoretically affect chromatin accessibility or TF binding if in a regulatory element (unlikely in coding region). Acceptable for clinical translation.

A8 (15% editing, Thr→Ala missense): Significant concern. (1) The Thr→Ala change removes a hydroxyl group from a conserved residue — this could affect protein folding, stability, or post-translational modification (if the Thr is a phosphorylation site). (2) 15% of the cell product would carry this unintended missense mutation. In a cell therapy product of ~10⁸ cells, that's ~15 million cells with a potentially deleterious edit. (3) Must determine: Is this Thr a known phosphorylation site (check PhosphoSitePlus)? Is it at a protein-protein interface? What is the conservation score (ConSurf)?

Mitigation strategies:

sgRNA redesign: Try alternative sgRNAs that shift the editing window to include A6 but exclude A8. ABE8e's window is positions 3-9; if A6 is at position 6 and A8 at position 8, using a different PAM that shifts A6 to position 4 would move A8 to position 6 (still in window — won't help) or to position 10 (outside window — would help). Systematically screen all available PAMs.
Use a narrower-window ABE: ABE8e has a broad editing window. ABE7.10 or engineered variants (e.g., ABE8e-V106W "SpABE8e") have narrower windows that could edit A6 while sparing A8.
If bystander is unavoidable: Perform functional assays — express the Thr→Ala variant in cells and assess: protein expression level, localization, and function in the relevant pathway. If the missense is truly neutral, proceed with documentation for regulatory filing.

Verification: llm-judge
Cascade risk: Undetected deleterious bystander → patient safety risk.

Step 3 — Quantitative follow-up

File: chain22_step3.json

Question: You identify an alternative sgRNA that achieves 55% on-target editing at A6 with only 3% bystander at A8 (acceptable). However, you need >50% editing for therapeutic efficacy, and the 55% is right at the margin. Design a manufacturing process for a clinical-grade base-edited T cell product that reliably achieves >50% editing across patient-derived cells, accounting for donor-to-donor variability. Include: starting material, critical process parameters, in-process controls, release criteria, and the key risk.
Ideal answer: Manufacturing process:

Starting material: Leukapheresis product (>2×10⁹ PBMCs). CD4+ T cell isolation by CliniMACS negative selection. Minimum 2×10⁸ CD4+ T cells.

Critical process parameters (CPPs):

Activation: Anti-CD3/CD28 (TransAct or Dynabeads), 72h, verify >80% CD25+/Ki-67+ before electroporation (in-process QC gate — do NOT proceed if <80% activated)
Electroporation: MaxCyte ExPERT (clinical-grade platform), ABE8e mRNA 2 µg + modified sgRNA 3 µg per 1×10⁶ cells. Process 2×10⁸ cells in ~200 reactions.
Post-EP culture: 5 days in X-VIVO 15 + 5% human AB serum + IL-2 (100 U/mL) + IL-7 (10 ng/mL) to promote survival and expansion.
Expected yield: 4-8× expansion = 0.8-1.6×10⁹ edited cells. Dose: 1×10⁸ to 1×10⁹.

In-process controls:

Day 0: Cell count, viability (>90%)
Day 3 (pre-EP): Activation markers (CD25, Ki-67 >80% gate)
Day 3 (4h post-EP): Viability check (>65% gate)
Day 5: Editing efficiency by ddPCR (faster than Sanger) — must be >50% at target, <5% at A8 bystander
Day 8: Final harvest

Release criteria:

Editing at A6: >50% (by amplicon NGS, 10,000× depth)
Bystander A8: <5%
Viability: >70%
Sterility: negative (14-day BacT)
Endotoxin: <5 EU/kg
Mycoplasma: negative
CD4+ purity: >90%
Residual ABE8e mRNA: below LOQ (RT-qPCR)

Key risk: Donor-to-donor variability. T cell activation kinetics, electroporation efficiency, and editing rates vary significantly between donors (typical range: 40-75% editing for the same protocol). The 55% average means some donors will fall below 50%. Mitigation: (1) Include a "rescue electroporation" step — if day 5 ddPCR shows <45% editing, perform a second electroporation on day 5 (cells are still dividing). (2) Develop a predictive model: correlate pre-EP T cell activation markers (Ki-67%, CD25 MFI) with editing efficiency across 20 donor validation runs to identify donors likely to fail. (3) Bank a backup unedited cell product for every patient in case of manufacturing failure.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 23: Sequence to Function (3 steps)

sequence_to_function — Novel AmpC β-lactamase from carbapenem-resistant Enterobacteriaceae

Step 1 — Identify protein from sequence

File: chain23_step1.json

Question: A clinical microbiology lab isolates a carbapenem-resistant Klebsiella pneumoniae from a bloodstream infection. WGS reveals a plasmid-borne gene encoding a novel protein. BLAST analysis shows 72% identity to AmpC β-lactamase from Citrobacter freundii and 68% identity to CMY-2 β-lactamase. The protein is 381 amino acids. What protein family does this belong to, what is its catalytic mechanism, and which conserved motifs would you expect to find?
Ideal answer: This belongs to the Class C (AmpC) serine β-lactamase family (Ambler classification), specifically a plasmid-mediated cephalosporinase related to the CMY family. Class C β-lactamases are serine hydrolases that inactivate β-lactam antibiotics by cleaving the β-lactam ring.

Catalytic mechanism: (1) The catalytic serine (typically Ser64 in AmpC numbering) performs a nucleophilic attack on the β-lactam carbonyl carbon, forming a covalent acyl-enzyme intermediate. (2) A water molecule activated by Tyr150 (acting as a general base, assisted by Lys67) hydrolyzes the acyl-enzyme, regenerating the active site.

Conserved motifs expected:

S-x-x-K motif (Ser64-X-X-Lys67): Contains the catalytic serine. The lysine activates the serine and stabilizes the transition state.
Y-A-N motif (Tyr150-Ala-Asn): Tyr150 acts as the general base for deacylation. This is the defining motif that distinguishes Class C from Class A β-lactamases (which use Glu166).
K-T-G motif (Lys315-Thr-Gly): Part of the Ω-loop, involved in substrate recognition.
H-x-x-P-Q-x motif in the H-10 helix region, contributes to the oxyanion hole.

Clinical significance: Plasmid-mediated AmpC enzymes (like CMY-2) confer resistance to: all penicillins, cephalosporins (including 3rd-gen ceftriaxone/ceftazidime), and are NOT inhibited by clavulanate or sulbactam (unlike Class A enzymes). They may show partial activity against carbapenems if combined with porin loss (OmpK35/36 mutations), explaining the carbapenem resistance phenotype.

Verification: llm-judge
Cascade risk: Wrong family assignment → wrong resistance profile prediction → wrong antibiotic selection.

Step 2 — Predict functional consequences of sequence differences

File: chain23_step2.json

Question: Compared to CMY-2 (the most common plasmid AmpC), this novel enzyme has three mutations near the active site: (1) G183D (in the Ω-loop), (2) N289S (near the R2 side-chain binding pocket), (3) T314A (in the KTG motif region, now KAG). MIC testing shows this isolate has: meropenem MIC = 16 µg/mL (resistant, breakpoint ≥4), ceftazidime MIC = 128 µg/mL (resistant), ceftazidime-avibactam MIC = 4 µg/mL (susceptible, breakpoint ≤8). Based on these mutations and the MIC profile, what is the likely extended-spectrum phenotype of this enzyme?
Ideal answer: (1) G183D (Ω-loop): The Ω-loop forms one wall of the active site and determines substrate specificity. Glycine-to-aspartate introduces a negative charge and larger side chain. In Class A β-lactamases, Ω-loop mutations are associated with extended-spectrum activity (e.g., ESBL phenotype). In AmpC, Ω-loop mutations can widen the active site cavity, accommodating the bulkier R1 side chains of carbapenems. Prediction: This mutation likely contributes to the carbapenem-hydrolytic activity.

(2) N289S (R2 pocket): The R2 pocket accommodates the C3/C4 substituents of β-lactams. Asparagine-to-serine is a subtle change (both polar, serine is smaller). A smaller residue expands the R2 pocket, potentially improving accommodation of the 6α-1R-hydroxyethyl group of carbapenems (which causes steric clash in standard AmpC). Prediction: Contributes to carbapenem hydrolysis.

(3) T314A (KTG → KAG): Threonine-to-alanine removes a hydroxyl that normally hydrogen-bonds with substrate. This may reduce catalytic efficiency against standard cephalosporins (consistent with the relatively normal ceftazidime MIC of 128 — high but not exceptionally elevated for an AmpC) while not affecting carbapenem hydrolysis.

Overall phenotype: This is likely an extended-spectrum AmpC (ESAC) — an AmpC with acquired carbapenemase activity through active-site mutations, analogous to how TEM-1 evolved into TEM-type ESBLs. The susceptibility to ceftazidime-avibactam (MIC 4) is informative: avibactam is a diazabicyclooctane inhibitor that covalently inactivates both Class A and Class C β-lactamases. This confirms the enzyme is a serine β-lactamase (not a metallo-β-lactamase, which avibactam cannot inhibit). Treatment: ceftazidime-avibactam is appropriate for this isolate.

Verification: llm-judge
Cascade risk: Wrong resistance mechanism → wrong antibiotic → treatment failure → patient death.

Step 3 — Design validation experiment

File: chain23_step3.json

Question: Design an experiment to confirm that the three mutations (G183D, N289S, T314A) are responsible for the carbapenem-hydrolytic activity and determine which mutations are necessary vs. sufficient. Include: cloning strategy, enzyme kinetics, and clinical correlate.
Ideal answer: Cloning and expression: Clone the novel AmpC gene and CMY-2 (reference) into pET28a with C-terminal His₆ tag. Generate all 7 combinatorial mutants on the CMY-2 backbone:
CMY-2 WT
CMY-2 + G183D
CMY-2 + N289S
CMY-2 + T314A
CMY-2 + G183D/N289S
CMY-2 + G183D/T314A
CMY-2 + N289S/T314A
CMY-2 + G183D/N289S/T314A (= novel enzyme)

Express in E. coli BL21(DE3), purify by Ni-NTA + SEC.

Enzyme kinetics: Measure Km and kcat for each variant against a substrate panel:

Nitrocefin (chromogenic, general β-lactamase substrate)
Ceftazidime (3rd-gen cephalosporin)
Meropenem (carbapenem)
Imipenem (carbapenem)

Use UV spectrophotometry (Δε at 297 nm for nitrocefin; Δε at 300 nm for meropenem). Calculate catalytic efficiency (kcat/Km) for each enzyme-substrate combination.

Predictions:

CMY-2 WT: kcat/Km for meropenem ≈ 10⁻³ µM⁻¹s⁻¹ (negligible carbapenemase)
G183D single: kcat/Km for meropenem ≈ 10⁻² µM⁻¹s⁻¹ (modest increase)
G183D/N289S double: kcat/Km for meropenem ≈ 10⁻¹ µM⁻¹s⁻¹ (clinically relevant)
Triple mutant: highest carbapenemase activity

Clinical correlate: Transform each variant into K. pneumoniae ATCC13883 (susceptible, with intact porins) and the same strain with OmpK36 deletion (porin-deficient). Measure meropenem MICs. Key prediction: Carbapenem resistance (MIC ≥4) requires both the enzyme mutations AND porin loss — neither alone is sufficient. This is the typical clinical scenario for AmpC-mediated carbapenem resistance.

Analysis: Two-way ANOVA: enzyme variant × porin status → MIC. Report which mutations are necessary (no single mutation achieves clinical resistance alone), which are sufficient in combination, and the epistatic interactions.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 24: Paper to Experiment (4 steps)

paper_to_experiment — PCSK9 and LDL receptor regulation in cardiovascular disease

Step 1 — Extract key finding from literature

File: chain24_step1.json

Question: PCSK9 (proprotein convertase subtilisin/kexin type 9; UniProt Q8NBP7, 692 aa) is secreted by hepatocytes and binds to the LDL receptor (LDLR) on the cell surface, promoting LDLR endocytosis and lysosomal degradation. This reduces LDLR recycling and increases plasma LDL-cholesterol. The crystal structure of PCSK9 (PDB: 2P4E, resolution 1.98 Å) reveals three domains: prodomain/inhibitor I9 (77-149), peptidase S8 catalytic domain (155-461), and a C-terminal V-domain. The PCSK9:EGF-A complex (PDB: 3BPS, resolution 2.41 Å) shows how PCSK9 binds the EGF-A repeat of LDLR. ClinVar lists 1,322 pathogenic PCSK9 variants. Open Targets ranks PCSK9 as the top target for total cholesterol measurement (score 0.7534, EFO_0004574). Loss-of-function PCSK9 mutations are associated with 28-40% lower LDL-C and 88% lower coronary heart disease risk. How do PCSK9 inhibitors (evolocumab, alirocumab) reduce LDL-C, and what is the key structural detail that makes antibody-based inhibition effective?
Ideal answer: PCSK9 inhibitors are monoclonal antibodies that bind to PCSK9 in the circulation and prevent it from engaging the LDLR EGF-A domain. With PCSK9 blocked: (1) LDLR is internalized with LDL particles in clathrin-coated pits as normal, (2) in the acidic endosome (pH ~5.5), without PCSK9 bound, the LDLR-LDL complex dissociates (LDL→lysosome for degradation), but (3) LDLR recycles back to the cell surface instead of being directed to the lysosome. This increases LDLR surface density 2-3 fold, dramatically enhancing hepatic LDL clearance.

Key structural detail: The PCSK9:LDLR interaction is pH-dependent and relatively weak at neutral pH (Kd ~170-600 nM at pH 7.4). At endosomal pH (~5.5), the affinity increases ~50-fold due to protonation of His residues at the interface (His226 on PCSK9 contacts Asp299 on EGF-A; protonation strengthens this salt bridge). This means PCSK9 primarily acts in the endosome, not at the surface. The antibodies (evolocumab/alirocumab) bind PCSK9 with much higher affinity (Kd ~10-100 pM) than the PCSK9-LDLR interaction, effectively sequestering PCSK9 before it can engage LDLR. The antibody epitope overlaps with the LDLR-binding surface on PCSK9, providing direct steric competition.

Genetic validation: The human genetics are remarkable — PCSK9 loss-of-function is one of the best-validated drug targets in cardiovascular medicine. Individuals with nonsense mutations (e.g., Y142X, C679X in African Americans) have 28-40% lower LDL and ~88% lower CHD risk with no apparent adverse effects, providing a lifetime "natural experiment" proving safety and efficacy.

Verification: llm-judge
Cascade risk: Wrong mechanism → misunderstand pH-dependent biology.

Data Provenance:

PDB 2P4E: Queried 2026-02-17, resolution 1.98 Å, released 2007-04-10. Title: "Crystal Structure of PCSK9"
PDB 3BPS: Queried 2026-02-17, resolution 2.41 Å, released 2008-02-12. Title: "PCSK9:EGF-A complex"
UniProt Q8NBP7 (PCSK9): 692 aa. Domains: Inhibitor I9 (77-149), Peptidase S8 (155-461). Active site: charge relay at 186, 226. Queried 2026-02-17.
ClinVar PCSK9: 1,322 pathogenic variants (queried 2026-02-17)
Open Targets: PCSK9-total cholesterol (EFO_0004574) 0.7534, APOB 0.7389, LDLR 0.7306 (queried 2026-02-17, verified 2026-02-17 16:45)

Step 2 — Quantitative data interpretation

File: chain24_step2.json

Question: The FOURIER trial (evolocumab, n=27,564) showed: LDL-C reduction from 92 mg/dL to 30 mg/dL (59% reduction). Primary endpoint (cardiovascular death, MI, stroke, hospitalization for angina, coronary revascularization): HR=0.85, p<0.001. But cardiovascular DEATH alone: HR=1.05, p=0.51 (non-significant, numerically slightly higher). A critic argues this means evolocumab "reduces events but doesn't save lives." Evaluate this claim quantitatively. Consider: (a) Was the trial powered to detect a mortality difference? (b) What is the expected mortality reduction for a 59% LDL-C lowering based on the statin literature (CTT meta-analysis shows 10% CV mortality reduction per 1 mmol/L LDL-C reduction)?
Ideal answer: (a) Power analysis for mortality endpoint: FOURIER had 1,616 primary endpoint events but only 251 CV deaths over 2.2 years median follow-up. With 251 events, the trial had ~25% power to detect a 15% mortality reduction (the plausible range). To detect a 15% CV mortality reduction with 80% power, you'd need ~1,200 CV deaths, requiring either 5× more patients or 5× longer follow-up. The trial was massively underpowered for the mortality endpoint. The HR of 1.05 (p=0.51) is entirely consistent with either no effect OR a 15% benefit — the confidence interval likely spans ~0.80 to 1.35.

(b) Expected benefit from CTT calibration: LDL-C reduced by 62 mg/dL = 1.6 mmol/L. CTT meta-analysis (statins) shows ~10% CV mortality reduction per 1 mmol/L over 5 years. Expected: ~16% CV mortality reduction for 1.6 mmol/L reduction, BUT this assumes 5 years of treatment. FOURIER had only 2.2 years median follow-up. Extrapolating: at 2.2 years, the expected mortality reduction is ~7-10%, corresponding to ~18-25 fewer CV deaths out of 251 — well within the noise of the study.

(c) Conclusion: The critic's argument is statistically naive. The non-significant mortality result does NOT mean "no mortality benefit" — it means the trial was too short and too small to detect the expected mortality benefit. The primary endpoint result (HR=0.85) is consistent with CTT-predicted benefit. Long-term open-label extension data (FOURIER-OLE, 7+ years) will be needed to confirm mortality benefit. This is a classic example of interpreting "absence of evidence" as "evidence of absence" — a fundamental statistical error.

Verification: llm-judge
Cascade risk: Wrong statistical reasoning → reject effective therapy.

Step 3 — Statistical test selection

File: chain24_step3.json

Question: You are designing a new PCSK9 inhibitor trial specifically powered for cardiovascular mortality. Using FOURIER data: CV death rate ~1.8%/year (placebo equivalent), expected HR ~0.85 with PCSK9 inhibition (based on CTT calibration for the LDL-C reduction achieved), 1:1 randomization. Calculate the required sample size and study duration to achieve 80% power at two-sided α=0.05.
Ideal answer: Using the log-rank test power formula for a survival endpoint:

Parameters:

CV death rate (control): λ₀ = 0.018/year
Expected HR: 0.85 (i.e., treatment rate λ₁ = 0.018 × 0.85 = 0.0153/year)
Need total events (d) for 80% power:

d = 4 × (Z₀.₀₂₅ + Z₀.₂₀)² / (ln(HR))² d = 4 × (1.96 + 0.842)² / (ln(0.85))² d = 4 × (2.802)² / (-0.1625)² d = 4 × 7.851 / 0.0264 d = 31.4 / 0.0264 d ≈ 1,189 CV death events needed

Sample size and duration trade-offs:

Option A: n = 30,000 (similar to FOURIER), follow-up 5 years. Expected events: ~30,000 × 0.0167 (average rate) × 5 ≈ 2,505 events → well-powered (even over-powered for HR 0.85).
Option B: n = 50,000, follow-up 3 years. Expected: ~50,000 × 0.0167 × 3 ≈ 2,505 events.
Option C: n = 20,000, follow-up 5 years. Expected: ~1,670 events → adequate but less margin.

Recommended design: n = 25,000-30,000, follow-up minimum 4-5 years. This provides robust power for CV mortality while being practically feasible with injectable PCSK9 inhibitors.

Key caveat: The control group rate (1.8%/year) assumes background statin therapy. If the trial is conducted in the era of highly effective LDL-lowering (most patients already on high-intensity statins), the residual CV death rate may be lower, requiring even more events. An adaptive design with pre-specified event-driven analysis (trigger at 1,200 CV deaths regardless of calendar time) is preferred.

Verification: llm-judge
Cascade risk: Terminal step.

Step 4 — Hypothesis generation

File: chain24_step4.json

Question: A new modality — inclisiran, a siRNA targeting PCSK9 mRNA in hepatocytes — achieves ~50% LDL-C reduction with only twice-yearly subcutaneous injections (vs. biweekly for evolocumab). Propose 3 testable hypotheses about whether inclisiran's mechanism (reducing PCSK9 synthesis vs. antibody-mediated extracellular sequestration) might produce different efficacy or safety outcomes compared to monoclonal antibodies.
Ideal answer: (1) Hypothesis: Inclisiran may have enhanced efficacy through intracellular PCSK9 depletion. PCSK9 acts both extracellularly (binding surface LDLR) and intracellularly (directing newly synthesized LDLR to lysosomes during secretory pathway transit). Monoclonal antibodies only block extracellular PCSK9. Inclisiran, by preventing PCSK9 synthesis entirely, also blocks the intracellular degradation pathway. Testable: Measure LDLR surface density and total cellular LDLR protein in primary human hepatocytes treated with: (a) evolocumab (extracellular only), (b) PCSK9 siRNA (both pathways), (c) combination. If intracellular pathway contributes, siRNA should produce more LDLR per cell than antibody despite similar LDL-C reduction (because intracellular LDLR pool is preserved).

(2) Hypothesis: Inclisiran's sustained PD effect may cause "rebound" LDL-C elevation if PCSK9 pathway adapts. Chronic PCSK9 depletion upregulates PCSK9 gene transcription via SREBP-2 (the same pathway that upregulates LDLR when cholesterol drops). With antibodies, elevated PCSK9 is simply sequestered. With siRNA, the mRNA is degraded, but SREBP-2-driven transcription may eventually overwhelm siRNA-mediated knockdown — especially as siRNA potency wanes before the next dose (day 120-180). Testable: Measure plasma PCSK9 levels and LDL-C at monthly intervals between doses. Predict: LDL-C nadir at 1-2 months, gradual rise months 4-6 as siRNA wanes, with possible overshoot above baseline if PCSK9 transcription is strongly upregulated.

(3) Hypothesis: Inclisiran's hepatocyte-specific mechanism may reduce neurocognitive safety signals. Evolocumab's EBBINGHAUS sub-study showed no cognitive effects, but concerns persist about very low LDL-C and CNS cholesterol. PCSK9 is expressed in the CNS (cortical neurons). Antibodies don't cross the BBB, so brain PCSK9 is unaffected. Inclisiran, a GalNAc-conjugated siRNA, is hepatocyte-specific (ASGPR-mediated uptake) and does NOT reach the brain. Both modalities should spare CNS PCSK9. Testable: This is actually a null hypothesis — both should have identical CNS safety. But if PCSK9 antibodies have any CNS effects (through rare BBB disruption or transport), inclisiran would not. Compare neurocognitive endpoints between large evolocumab and inclisiran trials using standardized instruments (CogState, CANTAB).

Verification: llm-judge
Cascade risk: Terminal step.

Chain 25: Paradox Resolution (3 steps)

paradox_resolution — Exercise-induced immunosuppression in marathon runners

Step 1 — Explain paradoxical result

File: chain25_step1.json

Question: Moderate exercise is immunostimulatory — it increases circulating NK cells, improves vaccine responses, and reduces infection risk. However, marathon runners and ultra-endurance athletes report 2-6× higher rates of upper respiratory tract infections (URTI) in the 1-2 weeks following a race compared to sedentary controls. This "open window" hypothesis suggests intense exercise transiently suppresses immunity. But recent re-analyses challenge this: URTI symptoms in runners may not be infections at all. A study of 155 marathon runners with post-race "cold symptoms" found that <30% had confirmed viral pathogens (by multiplex PCR); the majority had elevated markers of airway inflammation (IL-6, IL-8, neutrophil elastase) without viral etiology. Propose at least 3 hypotheses for why marathon runners get URTI symptoms that are NOT infections, ranked by biological plausibility.
Ideal answer: Hypothesis 1 (Most plausible): Exercise-induced airway inflammation and epithelial damage. Prolonged heavy breathing (>3 hours at 60-80% VO2max) exposes airway epithelium to massive volumes of air (increasing ventilation from ~6 L/min to >100 L/min). This causes: (1) airway drying and cooling (especially in cold weather), leading to epithelial cell damage and osmotic stress, (2) mechanical shear stress from turbulent airflow, (3) inhalation of pollutants, allergens, and particulates at greatly increased rates. Damaged airway epithelium releases DAMPs (damage-associated molecular patterns), IL-33, and thymic stromal lymphopoietin (TSLP), triggering local inflammation (neutrophil infiltration, mucus hypersecretion) that mimics URTI symptoms without any pathogen.

Hypothesis 2 (Plausible): Stress hormone-mediated mucosal immune redistribution. Marathon running causes sustained elevation of cortisol (3-5×), catecholamines (10-20×), and IL-6 (up to 100×). Cortisol causes transient lymphopenia (1-2h post-exercise) by redistributing lymphocytes from blood to tissues (mucosal surfaces, lungs, gut). This "immune cell trafficking" to mucosal sites could cause transient local inflammation as immune cells extravasate into tissues — producing sore throat, nasal congestion, and cough. The lymphopenia is not immunosuppression but immune redistribution. Symptoms resolve within 24-72h as cortisol normalizes.

Hypothesis 3 (Emerging): Reactivation of latent herpesviruses. Intense physiological stress can reactivate latent viruses (EBV, CMV, HSV-1) from lymphoid reservoirs. EBV reactivation (detectable by PCR as viral DNA in saliva) occurs in ~20% of marathon runners post-race. Subclinical viral shedding may produce mild pharyngitis without classical "infection" (multiplex PCR panels might not test for herpesviruses, or viral loads are below detection).

Hypothesis 4 (Possible): Exercise-induced bronchoconstriction (EIB). 10-50% of endurance athletes develop EIB, triggered by airway cooling/drying. Symptoms (cough, wheeze, chest tightness) overlap with URTI. Often undiagnosed in recreational runners.

Verification: llm-judge
Cascade risk: Wrong explanation → wrong intervention recommendations for athletes.

Step 2 — Design discriminating experiment

File: chain25_step2.json

Question: Your top two hypotheses are: (H1) Exercise-induced airway epithelial damage causing sterile inflammation, and (H2) Stress hormone-mediated immune cell redistribution to mucosal sites. Design ONE study that distinguishes these mechanisms in marathon runners.
Ideal answer: Study: Pre/post-marathon nasal lavage + blood sampling with epithelial damage markers

Participants: 60 marathon runners (finishers of a single event), 20 sedentary matched controls.

Sampling timepoints: Pre-race (morning of race), 1h post-race, 6h, 24h, 72h, 7 days.

Sample 1 — Nasal lavage (10 mL sterile saline per nostril):

Cell differential (cytospin: neutrophils, eosinophils, lymphocytes, epithelial cells)
Cytokines: IL-6, IL-8, IL-33, TSLP (epithelial damage markers), IFN-γ, TNF-α
Epithelial integrity marker: Club cell protein-16 (CC16) — a small protein normally sequestered in airway epithelium. When epithelium is damaged, CC16 leaks into the airway lumen and blood. Serum CC16 is the gold standard biomarker for airway epithelial permeability.
Calprotectin (S100A8/A9): Neutrophil-derived marker of active inflammation.

Sample 2 — Blood:

Serum CC16 (epithelial damage → CC16 crosses into blood)
Cortisol, epinephrine, norepinephrine
Complete blood count with differential (lymphocyte count for lymphopenia)
Flow cytometry: CD3/CD4/CD8/CD16/CD56 for lymphocyte subsets
Tissue-homing markers: α4β7 (gut-homing), CCR5/CXCR3 (inflammation-homing) on T cells

Symptom diary: Daily symptom score (Jackson cold score) for 14 days.

Expected if H1 (epithelial damage):

Serum CC16: Dramatically elevated at 1h (>5× baseline), slowly normalizing over 72h
Nasal IL-33/TSLP: Elevated at 1-6h (epithelial alarmins)
Nasal neutrophils: Elevated at 6-24h (sterile inflammation)
Cortisol: Elevated but does NOT correlate with CC16 or symptom severity (damage is mechanical, not hormonal)
Symptoms correlate with CC16 levels, not cortisol levels

Expected if H2 (immune redistribution):

Serum CC16: Normal or minimally elevated (no epithelial damage)
Blood lymphocytes: Drop at 1h (lymphopenia), rebound by 24h
Nasal lavage lymphocytes: Increase at 6-24h (redistribution to mucosa)
CCR5/CXCR3+ T cells: Depleted from blood, appearing in nasal lavage
Cortisol levels correlate with symptom severity and lymphocyte redistribution kinetics
Symptoms correlate with cortisol AUC, not CC16

Key discriminator: Serum CC16. If elevated → epithelial damage (H1). If normal → redistribution (H2).

Verification: llm-judge
Cascade risk: Wrong mechanism → wrong advice to athletes.

Step 3 — Synthesize conclusion from results

File: chain25_step3.json

Question: Results from your study (60 runners, 20 controls):

Marker	Pre-race	1h post	6h	24h	72h	Controls
Serum CC16 (ng/mL)	4.2	18.6***	12.1**	6.8*	4.5	4.0
Cortisol (µg/dL)	12	38***	22**	14	12	11
Blood lymphocytes (×10³/µL)	2.1	0.8***	1.6*	2.3	2.2	2.0
Nasal neutrophils (%)	5%	12%	35%***	42%***	18%*	6%
Nasal IL-33 (pg/mL)	15	85***	62***	28*	16	14
URTI symptoms (% runners)	0%	—	—	38%	42%	5%

Correlation analysis: Symptom severity at 24-72h correlated with: CC16 at 1h (r=0.68, p<0.001), cortisol at 1h (r=0.22, p=0.09), lymphocyte nadir (r=-0.15, p=0.24).

Which hypothesis is supported? What should marathon runners do to prevent post-race "infections"?

Ideal answer: H1 (epithelial damage) is strongly supported:
Serum CC16 is dramatically elevated at 1h (4.4× baseline), confirming airway epithelial barrier disruption.
Nasal IL-33 (an epithelial alarmin released upon damage) peaks at 1h (5.7× baseline), driving the subsequent neutrophilic inflammation.
The neutrophilic infiltration peaks at 24h (35-42%), which is when symptoms peak — consistent with sterile inflammation kinetics (not viral infection, which takes 24-72h for replication).
CC16 at 1h predicts symptoms at 24-72h (r=0.68) — the strongest correlation by far. Cortisol does not significantly correlate (r=0.22, p=0.09), and lymphocyte nadir is irrelevant (r=-0.15, NS).
H2 (redistribution) does occur (lymphopenia at 1h, cortisol elevation) but does NOT drive symptoms. The immune redistribution is a real phenomenon but a bystander effect.

Practical recommendations for marathon runners:

"URTI" symptoms are NOT infections — antibiotics are useless and inappropriate. Anti-inflammatory approaches are warranted.
Pre-race: Nasal saline gel or barrier spray (e.g., Pretz, Nasaleze) to protect epithelium from drying.
During race: Maintain hydration to minimize airway drying. Consider wearing a light buff/neck gaiter in cold weather to warm and humidify inspired air.
Post-race: Short course of intranasal corticosteroid (fluticasone) or nasal saline irrigation may reduce the sterile inflammatory response. NSAIDs (ibuprofen) may help if not contraindicated.
Reframe the "open window": The post-marathon vulnerability is not immune suppression — it is airway epithelial injury. Training the airway (progressive exposure to high-ventilation exercise) may build epithelial resilience, similar to how calluses protect skin.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 26: Data to Mechanism (3 steps)

data_to_mechanism — Unexpected synergy between venetoclax and azacitidine in AML

Step 1 — Interpret ambiguous data

File: chain26_step1.json

Question: Venetoclax (a selective BCL-2 inhibitor) has limited single-agent activity in AML (response rate ~19%). Azacitidine (a hypomethylating agent/DNA methyltransferase inhibitor) also has modest single-agent activity (~28% complete remission rate). However, the combination (VIALE-A trial) achieves ~66% complete remission in newly diagnosed elderly AML patients — far exceeding the additive expectation (~40%). Open Targets identifies DNMT3A (score 0.8296) and CEBPA (0.8444) as top AML targets; ClinVar reports 352 pathogenic DNMT3A variants. Propose at least 3 mechanistic hypotheses for this synergistic (not additive) combination effect.
Ideal answer: Hypothesis 1 (Strongest evidence): Azacitidine reduces MCL-1 expression, overcoming the primary resistance mechanism to venetoclax. AML blasts frequently co-express BCL-2 (venetoclax target) and MCL-1 (anti-apoptotic protein NOT inhibited by venetoclax). MCL-1 sequesters pro-apoptotic BH3 proteins (BIM, BAK), preventing apoptosis even when BCL-2 is blocked. Azacitidine reduces MCL-1 protein through multiple mechanisms: (a) DNA demethylation at the MCL-1 promoter can paradoxically increase expression of MCL-1 antisense transcripts, (b) azacitidine incorporation into RNA (it's also an RNA analog) disrupts MCL-1 mRNA processing, (c) azacitidine-induced ER stress activates the integrated stress response, which selectively reduces MCL-1 translation (MCL-1 mRNA is short-lived and translation-dependent). With MCL-1 reduced, cells become fully dependent on BCL-2 → venetoclax kills efficiently.

Hypothesis 2 (Mechanistically validated): Azacitidine activates pro-apoptotic BH3 genes through demethylation. Hypermethylation of promoters for pro-apoptotic genes (NOXA, BIM, BAD, HRK) is common in AML, reducing their expression. Azacitidine reverses this methylation, restoring expression of BH3-only proteins that activate apoptosis. These newly expressed BH3 proteins provide the "priming" signal that venetoclax needs — venetoclax blocks BCL-2 from neutralizing them, and the combination tips the balance toward apoptosis. Neither agent alone generates sufficient pro-apoptotic signal.

Hypothesis 3 (Metabolic): Venetoclax targets the mitochondrial metabolism that AML LSCs depend on. Leukemic stem cells (LSCs) in AML rely heavily on oxidative phosphorylation (OXPHOS) rather than glycolysis. BCL-2 inhibition disrupts the electron transport chain (BCL-2 interacts with Complex IV). Azacitidine reduces amino acid uptake (particularly cysteine, via suppression of SLC7A11), starving LSCs of substrates for the TCA cycle. The combination creates a double metabolic hit: reduced fuel supply (azacitidine) + disrupted OXPHOS machinery (venetoclax), selectively killing metabolically inflexible LSCs while sparing normal HSCs that can switch to glycolysis.

Verification: llm-judge
Cascade risk: Wrong synergy mechanism → wrong combination optimization.

Data Provenance:

Open Targets AML (EFO_0000222): CEBPA 0.8444, DNMT3A 0.8296, FLT3 0.8219 (queried 2026-02-17)
ClinVar DNMT3A: 352 pathogenic variants (queried 2026-02-17)
PDB 2QRV: DNMT3A-DNMT3L complex, 2.89 Å, released 2007-12-04 (queried 2026-02-17)
Clinical trial NCT03839771: Ivosidenib/enasidenib + induction, Phase III, ACTIVE_NOT_RECRUITING (queried 2026-02-17)

Step 2 — Update with new evidence

File: chain26_step2.json

Question: BH3 profiling (mitochondrial priming assay) is performed on AML blasts from 30 patients before treatment:
High BCL-2 dependence (primed by ABT-199 peptide): 18 patients → 78% CR with ven+aza
Low BCL-2 dependence: 12 patients → 42% CR with ven+aza
Pre-treatment MCL-1 protein (western blot, normalized): High MCL-1 group had 55% CR vs. 75% CR in low MCL-1 group
RNA-seq: Azacitidine treatment (day 8 biopsy, pre-venetoclax) showed MCL-1 mRNA reduced by 40% and NOXA mRNA increased by 3.2-fold in 22/30 patients

Which hypothesis from Step 1 is best supported? Can you now predict which patients will respond?

Ideal answer: All three hypotheses are partially supported, but Hypothesis 1 (MCL-1 reduction) and Hypothesis 2 (BH3 gene reactivation) are dominant:

Evidence for H1: MCL-1 protein levels inversely correlate with response (75% CR in low MCL-1 vs. 55% in high MCL-1). Azacitidine reduces MCL-1 mRNA by 40%, priming cells for venetoclax.

Evidence for H2: NOXA (a BH3-only protein that specifically neutralizes MCL-1) is upregulated 3.2-fold by azacitidine. This is complementary to H1 — azacitidine both reduces MCL-1 directly AND increases its antagonist NOXA. This double mechanism explains the synergy: cells that resist MCL-1 reduction may still respond to NOXA upregulation.

Predictive biomarker framework:

Best predictor: BH3 profiling — 78% CR in BCL-2-dependent blasts vs. 42% in non-dependent. This directly measures the functional requirement for BCL-2, integrating all upstream variables.
Supplementary: Pre-treatment MCL-1 protein level (high MCL-1 = partial resistance, may need MCL-1 inhibitor addition).
On-treatment: Day 8 biopsy showing MCL-1 reduction >30% and NOXA induction >2-fold predicts response. Patients NOT showing this on-treatment change may benefit from early addition of an MCL-1 inhibitor.

Combined predictor: BCL-2 dependent AND low MCL-1 → ~85% CR (identify the best responders). BCL-2 independent AND high MCL-1 → ~30% CR (candidates for alternative regimen).

Verification: llm-judge
Cascade risk: Wrong biomarker → wrong patient selection.

Step 3 — Correct prior analysis

File: chain26_step3.json

Question: A retrospective analysis of VIALE-A trial data stratified by IDH1/IDH2 mutation status (mutations present in ~15% of AML patients, detectable by ClinVar variants: IDH1 35 pathogenic, IDH2 80 pathogenic) reveals: IDH-mutant AML responds exceptionally well to ven+aza (CR rate 75% vs. 65% for IDH-WT). However, when these patients relapse, they lose the IDH mutation (IDH reversion to wild-type) in 40% of cases. This is unusual — most cancers acquire new mutations at relapse, not lose drivers. (a) Explain why IDH-mutant AML is particularly sensitive to venetoclax. (b) Why would relapsed disease LOSE the IDH mutation? (c) What does this mean for salvage therapy?
Ideal answer: (a) IDH mutation → venetoclax sensitivity: IDH1/2 mutations produce 2-hydroxyglutarate (2-HG), an oncometabolite that inhibits the α-ketoglutarate-dependent enzyme cytochrome c oxidase (Complex IV of the ETC). This forces AML cells to rely more heavily on BCL-2 to maintain mitochondrial membrane integrity and prevent apoptosis. BCL-2 dependence is therefore metabolically enforced in IDH-mutant AML. Additionally, 2-HG inhibits TET2 (a DNA demethylase), creating a hypermethylation phenotype that silences pro-apoptotic genes — azacitidine directly reverses this. The combination is mechanistically tailored: azacitidine reverses 2-HG-mediated methylation, restoring apoptotic priming, while venetoclax blocks the compensatory BCL-2 dependence.

(b) IDH mutation loss at relapse: The IDH mutation was a dependency for the original clone's survival strategy (BCL-2 dependence + differentiation block). Under venetoclax+azacitidine selective pressure, the IDH-mutant clone is preferentially killed. Relapse arises from a pre-existing IDH-WT subclone that was a minor population at diagnosis. This IDH-WT subclone survives because it's NOT BCL-2-dependent (uses MCL-1 or BFL-1 instead) and is NOT affected by 2-HG-driven metabolic rewiring. The "loss" of IDH mutation is clonal selection, not reversion.

(c) Implications for salvage therapy:

Do NOT add an IDH inhibitor (ivosidenib/enasidenib) at relapse if the IDH mutation is lost — there's no target.
The relapsed disease has fundamentally different biology: It's BCL-2-independent (explaining venetoclax resistance) and may be MCL-1-dependent. Salvage options: (a) MCL-1 inhibitor combinations, (b) conventional intensive chemotherapy if patient is fit, (c) targeted therapy based on whatever driver mutations the relapsed clone carries (re-sequence to identify new targets).
Clinical implication: Monitor IDH mutation status AND subclonal architecture at diagnosis using deep NGS (>1% VAF sensitivity). If IDH-WT subclones are detectable at >5% VAF at diagnosis, consider preemptive strategies to address both populations.

Verification: llm-judge
Cascade risk: Terminal step.

Data Provenance:

ClinVar IDH1: 35 pathogenic; IDH2: 80 pathogenic (queried 2026-02-17)
PDB 4JA8: IDH2 R140Q + AGI-6780 inhibitor, 1.55 Å, released 2013-04-10, X-ray (queried 2026-02-17)
Open Targets AML: DNMT3A 0.8296, FLT3 0.8219 (queried 2026-02-17)
ClinVar DNMT3A: 352 pathogenic; NPM1: 29 pathogenic (queried 2026-02-17)

Chain 27: Evidence Synthesis (3 steps)

evidence_synthesis — BRAF V600E inhibition in melanoma: lessons from vemurafenib resistance

Step 1 — Compare conflicting papers

File: chain27_step1.json

Question: Two landmark studies defined BRAF V600E inhibitor resistance in melanoma:

Paper A (BRIM-3 trial, NEJM 2011): Vemurafenib vs. dacarbazine in BRAF V600E melanoma. n=675. OS: 13.6 vs. 9.7 months. HR=0.70. Progression-free survival: 5.3 vs. 1.6 months.

Paper B (Molecular analysis of resistance, Nature 2012): Profiled 45 melanoma tumors that progressed on vemurafenib. Found: 40% had MAPK pathway reactivation (NRAS mutation, BRAF amplification, MEK1 mutation), 22% had PI3K pathway activation (PTEN loss, AKT amplification), 18% had both, 20% had no identifiable mechanism.

The crystal structure of BRAF V600E with vemurafenib (PDB: 3OG7, resolution 2.45 Å) shows the inhibitor binding the active kinase conformation. ClinVar lists 352 pathogenic BRAF variants. UniProt P15056 identifies BRAF as 766 aa with the kinase domain at 457-717. Open Targets links BRAF to melanoma indirectly (CDKN2A tops at 0.8458, PTEN at 0.7137). ChEMBL shows vemurafenib IC50 against BRAF V600E = 31 nM (CHEMBL1948324). Why does vemurafenib have such a short PFS (5.3 months) despite potent target inhibition, and what does the resistance landscape tell us about monotherapy limitations?

Ideal answer: Vemurafenib fails quickly despite potent BRAF inhibition because of several interacting factors:

Pathway redundancy: The MAPK pathway has extensive cross-talk and feedback regulation. When BRAF V600E is inhibited, negative feedback on RAS (mediated by ERK-dependent phosphorylation of SOS1) is released. This reactivates RAS, which can signal through: (a) WT BRAF via dimerization (vemurafenib paradoxically activates WT BRAF dimers — the "paradox effect"), (b) CRAF, which is not inhibited by vemurafenib, (c) direct RAS→PI3K signaling. These relief-of-feedback mechanisms provide escape routes within weeks.
Tumor heterogeneity: The 40% with MAPK reactivation, 22% PI3K, 18% both, 20% unknown shows that multiple distinct resistance mechanisms co-exist — likely in different subclones within the same tumor. Any monotherapy creates a bottleneck that selects for whichever pre-existing resistant subclone is present.
The 20% "unknown" mechanisms likely include non-genetic resistance: phenotypic switching to a mesenchymal/neural-crest-like state with reduced MAPK dependence, stromal HGF secretion activating MET, or epigenetic rewiring.
Short PFS reflects SELECTION, not mutation: Most resistance mechanisms are present as rare subclones at baseline. Vemurafenib rapidly kills the dominant BRAF-dependent population (explaining the dramatic initial response), but resistant subclones expand immediately. The 5.3-month PFS is essentially the time for a resistant subclone to grow from 0.1% to clinically detectable.

Monotherapy limitation: Targeting a single node in a highly redundant signaling network is fundamentally insufficient. This directly motivated the development of BRAF + MEK inhibitor combinations (dabrafenib + trametinib, PFS ~12 months, OS ~25 months) and now BRAF + MEK + anti-PD-1 triple therapy.

Verification: llm-judge
Cascade risk: Wrong resistance model → wrong combination strategy.

Data Provenance:

PDB 3OG7: Queried 2026-02-17, resolution 2.45 Å, released 2010-09-22. Title: "B-Raf Kinase V600E oncogenic mutant in complex with PLX4032"
UniProt P15056 (BRAF): 766 aa. Domains: RBD (155-227), Protein kinase (457-717). Active site: proton acceptor at 576. Queried 2026-02-17.
ClinVar BRAF: 352 pathogenic variants (queried 2026-02-17)
ChEMBL CHEMBL1229517 (vemurafenib): IC50 = 31 nM (BRAF, CHEMBL1948324), 61 nM (CHEMBL1948325), 190 nM (CHEMBL1948326). Max phase = 4. Queried 2026-02-17.
Open Targets melanoma (EFO_0000389): CDKN2A 0.8458, MITF 0.7498, PTEN 0.7137 (queried 2026-02-17)

Step 2 — Meta-analytic reasoning

File: chain27_step2.json

Question: Subsequent trials tested combination approaches in BRAF V600E melanoma:

Trial	Treatment	N	Median PFS	Median OS	HR (OS)
BRIM-3	Vemurafenib mono	675	5.3 mo	13.6 mo	ref
coBRIM	Vemurafenib + cobimetinib	495	12.3 mo	22.5 mo	0.70
COMBI-d	Dabrafenib + trametinib	423	11.0 mo	25.1 mo	0.71
KEYNOTE-022	Dabrafenib + trametinib + pembrolizumab	120	16.9 mo	32.7 mo	~0.56

(a) What is the pattern in PFS and OS across generations of therapy? (b) Is there diminishing returns with each additional agent? (c) How would you estimate the relative contribution of each drug component?

Ideal answer: (a) Progressive improvement with each generation:
Monotherapy: PFS 5.3 mo, OS 13.6 mo
BRAF+MEK: PFS 11-12 mo, OS 22-25 mo (PFS ~2.2×, OS ~1.7×)
BRAF+MEK+PD-1: PFS 16.9 mo, OS 32.7 mo (PFS ~1.4× over doublet, OS ~1.4×)

(b) Diminishing marginal returns: Each additional agent provides less absolute PFS gain:

Adding MEK to BRAF: +6.3 months PFS (massive improvement)
Adding PD-1 to BRAF+MEK: +5.3 months PFS (substantial but smaller) The OS gains are more proportional because immunotherapy provides long-term survival "tails" (patients who become long-term survivors, visible only in OS data). The PFS benefit may understate the immunotherapy contribution because some patients develop durable immune responses that aren't captured by RECIST-based PFS.

(c) Relative contribution estimation: This requires caution because trials have different populations and timeframes. However, using a framework:

BRAF inhibitor alone: blocks primary driver → dramatic initial response but short duration
Adding MEK inhibitor: blocks the most common resistance escape (MAPK reactivation) → doubles PFS
Adding anti-PD-1: adds an entirely orthogonal mechanism (immune-mediated tumor killing) that can produce durable responses independent of targeted therapy resistance

A formal approach: Construct a network meta-analysis (NMA) using the BRAF-mono arm as common comparator. Estimate indirect comparison of doublet vs. triplet adjusting for cross-trial differences. The "components analysis" approach (factorial trials like KEYNOTE-022 which randomized to doublet±pembrolizumab) directly estimates the pembrolizumab contribution: OS HR for adding pembrolizumab ≈ 0.56/0.71 ≈ 0.79 (roughly 21% further mortality reduction from immunotherapy addition).

Key insight: Targeted therapy and immunotherapy address DIFFERENT failure modes. Targeted therapy extends the time before resistant clones dominate. Immunotherapy provides a separate mechanism that can eliminate resistant clones if the immune system recognizes them. The optimal strategy likely involves all three simultaneously, not sequentially.

Verification: llm-judge
Cascade risk: Wrong component attribution → wrong trial design.

Step 3 — Clinical recommendation

File: chain27_step3.json

Question: A 55-year-old patient presents with BRAF V600E metastatic melanoma, ECOG PS 0, no brain metastases, LDH normal. Treatment options include: (a) BRAF+MEK (dabrafenib+trametinib), (b) anti-PD-1 monotherapy (pembrolizumab or nivolumab), (c) anti-PD-1 + anti-CTLA-4 (nivolumab+ipilimumab), (d) BRAF+MEK+anti-PD-1 triplet. Based on your evidence synthesis, which would you recommend first-line and why? Address both rapid response need and long-term survival.
Ideal answer: Recommended: (c) Nivolumab + ipilimumab (nivo+ipi) as preferred first-line, with BRAF+MEK as rescue.

Rationale:

Immunotherapy first, targeted therapy at progression. The DREAMseq trial (ECOG-ACRIN EA6134) directly tested sequencing: anti-PD-1+anti-CTLA-4 first → BRAF+MEK at progression vs. BRAF+MEK first → immunotherapy at progression. 2-year OS was 72% for immunotherapy-first vs. 52% for targeted-therapy-first. This is the most important data point: sequence matters, and immunotherapy first is superior.
Why nivo+ipi over pembrolizumab alone: In BRAF V600E melanoma, nivo+ipi achieves higher response rates (~60% vs. ~42%) and more durable responses than anti-PD-1 alone. The 5-year OS for nivo+ipi is ~50-60% across CheckMate trials.
Why NOT the BRAF+MEK+anti-PD-1 triplet: While the triplet has the best PFS/OS numbers, it comes with significantly higher toxicity (grade 3-4 AEs ~73% for KEYNOTE-022 triplet vs. ~55% for nivo+ipi vs. ~30% for dabrafenib+trametinib). In a PS 0 patient with normal LDH (good prognosis features), maximum front-line intensity may not be needed, and toxicity from the triplet may compromise the patient's ability to receive subsequent lines.
When to use BRAF+MEK first instead:
- Symptomatic, high-volume disease requiring rapid response (BRAF+MEK response rate >60% with rapid onset within 2 weeks, vs. immunotherapy which may take 2-3 months)
- Brain metastases (BRAF+MEK has better CNS penetration)
- High LDH (poor prognosis, may not survive long enough for immunotherapy to work)
For this specific patient (PS 0, no brain mets, normal LDH = favorable prognosis): nivo+ipi first-line, accepting the ~55% grade 3-4 toxicity rate (mostly manageable immune-related AEs). If progression after immunotherapy, switch to dabrafenib+trametinib. This sequence maximizes long-term survival probability.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 28: Sequence to Function (3 steps)

sequence_to_function — Identifying a novel CRISPR-Cas effector from metagenomic data

Step 1 — Identify protein from sequence

File: chain28_step1.json

Question: Metagenomic sequencing of a hot spring microbial community (78°C, pH 3.2, Yellowstone National Park) reveals a CRISPR array flanked by a novel open reading frame. The predicted protein is 1,243 amino acids. HHpred analysis shows weak homology (probability 85%) to TnpB (a nuclease associated with IS200/IS605 transposable elements) and structural similarity to the RuvC-like domain of Cas12a. But the protein is ~300 aa larger than Cas12a and contains an additional N-terminal domain with no detectable homology. What protein family does this likely represent, and what is its predicted function?
Ideal answer: This protein is likely a novel type V CRISPR-Cas effector in the Cas12 superfamily, potentially representing a new Cas12 subtype or an ancestor of known Cas12 effectors. The evidence:

TnpB homology is diagnostic: TnpB is the evolutionary ancestor of type V Cas effectors (including Cas12a/b/c/d/e). The homology to TnpB's RuvC domain indicates this protein uses the same RuvC-fold catalytic mechanism for DNA cleavage. RuvC-domain nucleases use a single active site with D-E-D metal coordination motif for sequential nicking of both DNA strands.
Size analysis: At 1,243 aa, this is significantly larger than Cas12a (~1,300 aa — actually similar!) but much larger than TnpB (~400 aa). The additional ~300 aa N-terminal domain beyond Cas12a size could be: (a) a target recognition domain (PAM-interacting domain equivalent), (b) a second nuclease domain (making this potentially dual-nuclease like Cas9's RuvC+HNH), (c) a HEPN domain for RNA cleavage (like Cas13 effectors), or (d) a DNA-binding domain for enhanced target specificity.
Environmental context matters: The extremophilic source (78°C, pH 3.2) means this protein is thermostable and acid-tolerant. If it functions as a programmable nuclease, it would be active at temperatures where mesophilic Cas9/Cas12a denature — potentially useful for high-temperature diagnostic assays (e.g., combining with PCR without separate enzyme addition) or industrial biotechnology (editing thermophilic organisms for biofuel production).
CRISPR array association confirms it's a bona fide Cas effector (not just a mobile genetic element nuclease), and it likely uses the adjacent CRISPR spacers as guide sequences.

Predicted function: RNA-guided DNA endonuclease, processing its own crRNA from the CRISPR array, and cleaving double-stranded DNA targets complementary to the spacer sequence, with a preference for a specific PAM sequence adjacent to the target.

Verification: llm-judge
Cascade risk: Wrong family assignment → wrong biochemical predictions → wrong characterization experiments.

Step 2 — Predict functional consequences of sequence differences

File: chain28_step2.json

Question: Compared to SpCas12a (Acidaminococcus sp., the most widely used Cas12a ortholog), this hot-spring effector has these notable features: (1) The RuvC catalytic residues are D576, E688, D891 — conserved in position but with a unique insertion of 47 amino acids between the D576 and E688 residues (Cas12a has ~30 aa between equivalent residues). (2) The N-terminal unknown domain (residues 1-320) contains a putative zinc finger motif (CxxC...CxxC). (3) The PAM-interacting domain (predicted, C-terminal) has basic residues (Arg, Lys) at positions that align with Cas12a's PAM-recognition arginines but is divergent in sequence. How might each feature affect this effector's properties as a genome editing tool?
Ideal answer: (1) 47-aa insertion between RuvC catalytic residues: The RuvC domain cleaves DNA by a two-metal-ion mechanism where D576, E688, and D891 coordinate Mg²⁺ ions. The 47-aa insertion (vs. ~30 aa in Cas12a) between the first two catalytic residues likely forms an expanded loop that contacts the non-target strand DNA. This could: (a) alter the geometry of non-target strand loading and cleavage, potentially changing the stagger between nicks on the two strands (Cas12a creates staggered cuts with 5-nt 5' overhangs; this effector might produce different overhangs), (b) the loop could be an insertion site for engineering — it's distal from catalytic residues, so modifications might be tolerated, enabling domain fusions without disrupting nuclease activity, (c) the larger insertion may slow catalysis (more conformational rearrangement needed) but increase specificity (more contacts with DNA).

(2) N-terminal zinc finger domain (residues 1-320): CxxC...CxxC zinc finger motifs mediate DNA or protein binding. In a CRISPR effector, this could serve as: (a) additional DNA-binding domain that contacts sequences flanking the target, providing a "second address" for target recognition — this would dramatically increase specificity beyond guide-RNA complementarity alone, (b) protein-protein interaction domain for recruiting host factors (rare in CRISPR effectors but found in some type III systems), (c) self-targeting prevention — zinc finger binding to host DNA could prevent autoimmunity against the CRISPR array itself. For genome editing: If the zinc finger provides additional specificity, this effector could be inherently more specific than Cas9/Cas12a, reducing off-target effects without requiring high-fidelity engineering.

(3) Divergent PAM-interacting domain: The PAM (protospacer adjacent motif) determines which sequences can be targeted. Divergent basic residues suggest a different PAM requirement than Cas12a's TTTV. Given the AT-rich genomes of extremophilic organisms, the PAM may be GC-rich (complementary environmental pressure). For genome editing: a different PAM expands the targetable sequence space. Characterizing the PAM experimentally (using a PAM depletion assay with a randomized PAM library) is a priority.

Verification: llm-judge
Cascade risk: Wrong feature predictions → wrong characterization priorities.

Step 3 — Design validation experiment

File: chain28_step3.json

Question: Design a comprehensive characterization experiment for this novel CRISPR effector to determine: (a) its nuclease activity and substrate preference, (b) its PAM requirement, (c) its temperature optimum, and (d) whether it has potential as a genome editing tool. Include controls and key success criteria.
Ideal answer: Phase 1 — Biochemical characterization (in vitro):

Expression: Codon-optimize for E. coli, clone into pET-based system with MBP-His₆ tag, express at 18°C (despite being a thermophilic protein, soluble expression in E. coli often requires low temperature). Purify: Ni-NTA → MBP cleavage (TEV protease) → ion exchange → SEC. Confirm monodisperse peak.

(a) Nuclease activity:

Reconstitute RNP with in vitro transcribed crRNA (from the native CRISPR array, first 3 spacers)
Substrates: dsDNA plasmid, ssDNA, ssRNA, dsRNA (test all — some Cas12 variants have collateral ssDNA/RNA cleavage)
Conditions: Buffer with 5 mM MgCl₂, test at 37°C, 55°C, 65°C, 78°C (native), 85°C
Readout: Agarose gel for plasmid linearization (dsDNA nicking or cutting)
Controls: No crRNA (tests non-specific nuclease), catalytic dead (D576A) mutant, SpCas12a + matched crRNA
Success: Clean dsDNA linearization dependent on crRNA + correct spacer complementarity

(b) PAM determination — PAM depletion assay:

Construct plasmid library with a fixed target sequence (matching spacer 1) flanked by 7N randomized PAM (4⁷ = 16,384 variants)
Incubate library with purified RNP at 65°C for 1h
Run cut plasmids on gel, extract uncut band (PAMs that were NOT recognized)
Deep sequence the uncut fraction
PAMs enriched in uncut = NOT recognized; PAMs depleted from uncut = recognized
Expected: A 2-4 nt PAM with GC-rich preference

(c) Temperature optimum:

Activity assay (plasmid linearization) across 25-95°C range (5°C increments)
Quantify by gel densitometry → plot activity vs. temperature
Measure thermal stability by DSF (Tm)
Expected: Activity optimum 65-80°C, Tm >85°C. >50% activity retained at 70°C.

(d) Genome editing potential:

Humanize: Codon optimize for human cells, add 2× NLS (N and C terminal)
Test in HEK293T at 37°C: RNP delivery targeting AAVS1 safe harbor locus
Readout: T7E1 assay and amplicon NGS for indel frequency
Compare to SpCas12a targeting adjacent site
Success criteria: >10% indel frequency at 37°C would be remarkable for a thermophilic enzyme (most lose significant activity). If <5% at 37°C, test at 42°C (mild hyperthermia) or use the effector for in vitro diagnostics instead.
Key experiment: If the zinc finger domain contributes to specificity, compare on-target/off-target ratio (GUIDE-seq or CIRCLE-seq) to SpCas12a. Predict: higher specificity (fewer off-targets) due to dual recognition (guide + zinc finger).
Verification: llm-judge
Cascade risk: Terminal step.

Chain 29: Stats Pipeline (3 steps)

stats_pipeline — Single-cell RNA-seq analysis of tumor-infiltrating lymphocytes in melanoma

Step 1 — Choose statistical framework

File: chain29_step1.json

Question: You have single-cell RNA-seq data (10x Chromium, 3' gene expression) from tumor biopsies of 8 melanoma patients: 4 responders and 4 non-responders to anti-PD-1 therapy. After quality control and filtering (removing doublets, low-quality cells, dead cells), you have 42,000 cells with 2,000 median genes per cell. You want to identify CD8+ T cell states that are enriched in responders vs. non-responders. What is the appropriate computational and statistical pipeline? Why is differential expression between responders and non-responders at the single-cell level statistically problematic?
Ideal answer: Pipeline:

Preprocessing: Scanpy or Seurat. Normalize (scran or SCTransform), select 2,000 HVGs, PCA (50 components), batch correction (Harmony or scVI) across patients.
Clustering: Build KNN graph → Leiden clustering → annotate clusters using known markers (CD8+ T cells: CD8A, CD8B, GZMB; exhausted: PDCD1, LAG3, HAVCR2, TOX; memory: IL7R, TCF7; effector: PRF1, GZMA).
Sub-clustering CD8+ T cells: Extract CD8+ cells, re-normalize, re-cluster to identify fine-grained states (naive, effector, memory, exhausted, progenitor-exhausted, terminally exhausted).
Differential abundance testing: For each CD8+ sub-cluster, compare the PROPORTION of that cluster between responders and non-responders.

Why single-cell DE between conditions is problematic: The fundamental issue is pseudoreplication. Each patient contributes thousands of cells, but cells from the same patient are NOT independent observations — they share genetic background, tumor microenvironment, treatment timing, and technical batch effects. If you run a Wilcoxon test comparing 20,000 CD8+ cells from responders vs. 18,000 from non-responders, the effective sample size is n=4 vs. n=4 (patients), not 20K vs. 18K. The inflated sample size produces absurdly small p-values for biologically trivial differences.

Correct approaches:

Pseudobulk DE: Aggregate expression per patient per cluster (sum or mean), then run DESeq2/edgeR on the pseudobulk matrix with n=4 vs. n=4. This correctly uses patients as the unit of replication.
Mixed-effects models: MAST (Model-based Analysis of Single-cell Transcriptomics) with patient as a random effect, condition as fixed effect. This accounts for within-patient correlation.
Differential abundance: Use Milo (milopy) or DA-seq to test whether neighborhoods in the UMAP are enriched in responders. These use patient-level replication for statistical testing.
For abundance: Use a beta-binomial regression or Dirichlet-multinomial model with patient-level proportions.

Verification: llm-judge
Cascade risk: Pseudoreplication → false discoveries → wrong biomarker → failed validation.

Step 2 — Multiple testing correction

File: chain29_step2.json

Question: Your pseudobulk DE analysis (DESeq2, n=4 vs. n=4 patients) on the "progenitor-exhausted" CD8+ T cell cluster (TCF7+PD-1+, 3,200 cells) identifies 156 differentially expressed genes (FDR <0.05) between responders and non-responders. Your PI wants to perform pathway enrichment on these 156 genes AND correlate the proportion of this cluster with response AND test 12 clinical variables (age, sex, tumor burden, prior therapy, etc.) as confounders. (a) How many total statistical tests are you now performing? (b) Should you correct across all analyses or within each analysis? (c) A reviewer later asks: "With only n=4 per group, are your 156 DE genes reliable?"
Ideal answer: (a) Total tests:
Pseudobulk DE: ~15,000 genes tested → 156 hits at FDR <0.05 (already corrected)
Pathway enrichment: ~5,000 GO terms tested → BH-corrected within
Proportion correlation: 1 test (cluster proportion vs. response)
Clinical confounders: 12 variables, each tested for association with response and with cluster proportion = 24+ tests

Total across all analyses: ~20,000+ tests, but they're organized in modules.

(b) Correction strategy: Correct within each analysis module, not across all simultaneously. Rationale: (1) The DE analysis and pathway analysis are sequential (pathway depends on DE results) — they're one analytical unit, already FDR-corrected. (2) The confounder analysis is a separate question (asking "is the biological finding robust to confounders?"), and should be Bonferroni-corrected within (0.05/12 ≈ 0.004 for each clinical variable). (3) Cross-module correction (e.g., correcting pathway p-values together with clinical confounder p-values) would be overly conservative and scientifically meaningless — these test different hypotheses.

(c) Are 156 DE genes reliable with n=4? This is the critical question:

Statistical concern: With n=4 per group, power is severely limited. DESeq2 with 4 vs. 4 has ~20-30% power to detect a 2-fold change. The 156 genes likely represent only the largest effect sizes — many true DE genes are missed (high false negative rate). However, the 156 hits at FDR<0.05 are unlikely to be false positives — FDR is well-calibrated even at small sample sizes (it may be conservative, not liberal).
Biological concern: Inter-patient variation in the CD8+ transcriptome is enormous. 4 patients per group may not represent the true responder/non-responder distinction if there are subtypes within each group.
Recommendation: (1) Report the 156 genes as "discovery" findings requiring validation. (2) Validate the top 20 genes by orthogonal methods (CITE-seq, flow cytometry) in an independent cohort. (3) Use gene set enrichment analysis (GSEA, pre-ranked) as a complement to thresholded DE — it captures coordinated pathway-level changes with better power than single-gene tests.
Verification: llm-judge
Cascade risk: Over-interpreting underpowered results → non-reproducible findings.

Step 3 — Pathway interpretation

File: chain29_step3.json

Question: GSEA (pre-ranked by DESeq2 log2FC × -log10(p)) on the progenitor-exhausted CD8+ cluster reveals:

Pathway	NES	FDR	Leading edge genes
Wnt/β-catenin signaling	+2.8	<0.001	TCF7, LEF1, MYC, CTNNB1
Oxidative phosphorylation	+2.2	0.003	NDUFA, SDHA, COX5B, ATP5F1
Glycolysis	-1.9	0.015	HK2, LDHA, PKM, SLC2A1
T cell exhaustion signature	-2.5	<0.001	PDCD1, LAG3, ENTPD1, HAVCR2
IFN-γ response	+1.6	0.045	STAT1, IRF1, GBP1, IDO1

Positive NES = enriched in responders. Interpret this profile biologically. What does it tell us about the functional state of CD8+ T cells that predict immunotherapy response?

Ideal answer: This is a remarkably coherent biological picture of the "stem-like" CD8+ T cell state that predicts immunotherapy response:

1. Wnt/β-catenin signaling (NES +2.8, responders): TCF7 (encoding TCF-1, the master transcription factor of progenitor-exhausted T cells) heads the leading edge. TCF-1+ PD-1+ CD8+ T cells represent the "stem-like" reservoir that self-renews AND differentiates into effector cells upon PD-1 blockade. This is arguably THE key finding — responders have more Wnt-active, self-renewing T cell progenitors that can mount a sustained anti-tumor response when unleashed by anti-PD-1.

2. OXPHOS up + Glycolysis down (responders): Progenitor-exhausted T cells rely on mitochondrial OXPHOS for energy (like memory T cells), whereas terminally exhausted T cells shift to glycolysis (like effector T cells in metabolic crisis). The metabolic profile of responder T cells is metabolically fit — they have functional mitochondria supporting long-term survival and self-renewal.

3. Exhaustion signature DOWN (responders): Lower expression of exhaustion markers (PD-1, LAG-3, CD39/ENTPD1, TIM-3) in responders' progenitor-exhausted cells. This seems paradoxical — these cells are defined by being PD-1+ — but the DEGREE of exhaustion marker expression matters. Responders' progenitor cells express moderate PD-1 (enough to define them) but haven't progressed to the terminal exhaustion state with multi-marker co-expression (PD-1+++/LAG-3+/TIM-3+/CD39+).

4. IFN-γ response (modestly enriched in responders): Indicates these cells are capable of responding to inflammatory signals — they're not anergic. However, the modest enrichment (NES 1.6, FDR 0.045) suggests this is a readiness state, not active IFN-γ production.

Integrated model: Responders harbor a larger reservoir of metabolically fit, Wnt-active, self-renewing CD8+ T cell progenitors that haven't terminally differentiated. Anti-PD-1 therapy specifically expands this population — without sufficient progenitors, there's nothing to expand, explaining non-response.

Clinical translation: TCF7+ CD8+ T cell frequency in pre-treatment biopsies could serve as a predictive biomarker for anti-PD-1 response. Several retrospective studies support this (Sade-Feldman et al., Cell 2018). Prospective validation needed.

Verification: llm-judge
Cascade risk: Terminal step.

Chain 30: Critical Appraisal (3 steps)

critical_appraisal — Microbiome manipulation for immunotherapy response in melanoma

Step 1 — Evaluate strength of evidence

File: chain30_step1.json

Question: Three high-profile studies report that gut microbiome composition predicts melanoma response to anti-PD-1:

Study 1 (Science, 2018, n=112): Faecalibacterium prausnitzii enriched in responders (16S rRNA sequencing). Germ-free mice colonized with responder stool showed better anti-PD-L1 response.

Study 2 (Science, 2018, n=42): Bifidobacterium longum enriched in responders (shotgun metagenomics). FMT from responders to germ-free mice improved anti-tumor immunity.

Study 3 (Nature Medicine, 2021, n=16): Fecal microbiota transplant (FMT) from responders to anti-PD-1-refractory melanoma patients. 6/15 (40%) showed clinical benefit (partial response or stable disease).

A pharma company wants to develop a defined bacterial consortium (not FMT) containing F. prausnitzii, B. longum, and Akkermansia muciniphila as an adjunct to pembrolizumab. They cite these studies as "proof of concept." Evaluate whether the evidence supports this development plan.

Ideal answer: The evidence is suggestive but insufficient to justify a specific consortium. Multiple critical weaknesses:

Different "key" species across studies: Study 1 identifies F. prausnitzii, Study 2 identifies B. longum, other studies identify Akkermansia or Ruminococcaceae. The lack of convergence on specific species across independent cohorts is a major red flag — it suggests the signal may be at the community/ecosystem level (diversity, metabolite output) rather than individual species.
Correlation ≠ causation confounders: Responders and non-responders differ in many ways that affect the microbiome: (a) antibiotic use (non-responders more likely received prior antibiotics), (b) diet (responders may have higher fiber intake), (c) bowel habits, BMI, geography, prior treatments. Studies 1 and 2 did not adequately control for these.
Mouse model translation gap: Germ-free mice have profoundly abnormal immune systems (underdeveloped Peyer's patches, reduced IgA, altered T cell repertoire). Showing that human stool "works" in germ-free mice demonstrates that microbiota CAN affect anti-tumor immunity, but the specific species responsible may differ from what works in humans with established, complex microbiomes.
Study 3 (FMT) is encouraging but very preliminary: n=16, no control arm (no sham FMT), 40% benefit could include natural fluctuation. The 6 responders may have had favorable immune biology independent of FMT.
A defined consortium is NOT FMT: The consortium assumes 3 named species are the active components. But FMT contains >1,000 species, bacteriophages, metabolites (short-chain fatty acids, secondary bile acids), and immunomodulatory molecules. Removing >99% of this complexity and expecting the same effect is a large assumption.

Recommendation: The development plan needs a Phase I/II randomized trial of the consortium + pembrolizumab vs. pembrolizumab alone in anti-PD-1-naive melanoma, with: (a) 16S + shotgun metagenomics + metabolomics at baseline and on-treatment, (b) stool SCFA and bile acid profiling, (c) tumor biopsy IHC for CD8+ TILs and PD-L1, (d) correlation of engraftment with response.

Verification: llm-judge
Cascade risk: Premature investment in unvalidated consortium → failed expensive trial.

Step 2 — Integrate contradictory evidence

File: chain30_step2.json

Question: A new large study (Nature, 2024, n=850 melanoma patients across 5 countries, shotgun metagenomics) reports: (a) No single bacterial species consistently associates with anti-PD-1 response across all cohorts. (b) Microbiome DIVERSITY (Shannon index) is the only consistent predictor (high diversity = better response, OR=1.8, p<0.001). (c) Prior antibiotic use within 30 days is the strongest negative predictor (OR=0.35, p<0.001), and antibiotic users have lower diversity. (d) The study explicitly tested the specific species from Studies 1-3 (F. prausnitzii, B. longum, A. muciniphila) and found: inconsistent direction of effect across cohorts, no species reached significance in >3 of 5 cohorts. How does this change the development plan?
Ideal answer: This substantially changes the landscape:

Species-level approach is likely wrong. The failure to replicate specific species associations across 5 countries with 850 patients is near-definitive. The individual species identified in smaller studies were likely cohort-specific confounds (dietary differences, geography, batch effects in sequencing). The defined consortium plan should be reconsidered — it's targeting the wrong level of biological organization.
Diversity, not composition, is the signal. Shannon diversity predicting response (OR=1.8) with antibiotic use as the dominant negative predictor suggests that immune competence requires a complex, diverse microbiome — not specific species. A diverse microbiome produces a broader spectrum of metabolites (SCFAs, bile acids, tryptophan catabolites) that collectively maintain gut barrier integrity and train mucosal immune cells.
Revised development strategy:
- Abandon the 3-species consortium unless Phase I shows clear engraftment and metabolite changes
- Pivot to full-diversity FMT from healthy donors (screened for high Shannon diversity), randomized against placebo FMT + pembrolizumab
- Alternatively: Antibiotic stewardship may be the most impactful intervention — a clinical guideline to avoid antibiotics within 60 days of immunotherapy initiation could be tested in a pragmatic trial with minimal cost
- Postbiotic approach: If specific metabolites (butyrate, inosine, specific bile acids) mediate the effect, these could be administered directly without live bacteria — avoiding engraftment challenges entirely
The antibiotic finding is immediately actionable: Oncologists should be informed that periprocedural antibiotics may harm immunotherapy outcomes. This should prompt prospective trials of antibiotic-sparing protocols in immunotherapy patients.

Verification: llm-judge
Cascade risk: Continuing species-level approach after contradictory evidence → wasted investment.

Step 3 — Design definitive experiment

File: chain30_step3.json

Question: Based on your synthesis — diversity predicts response, antibiotics harm response, specific species don't replicate — design a trial that definitively tests whether microbiome manipulation improves anti-PD-1 efficacy. Include: intervention, control, patient population, endpoints, and how you address the key confounders (antibiotics, diet, geography).
Ideal answer: MICRO-PD1: Microbiome Intervention for Cancer Response Optimization

Design: Phase II, randomized, double-blind, 2×2 factorial, multi-center (10 sites across 3 countries to capture geographic diversity)

Population: Treatment-naive advanced melanoma (BRAF V600E or WT), planned for pembrolizumab monotherapy. n=400 (100 per arm). Exclude: antibiotic use within 60 days, active GI disease, prior immunotherapy.

Factor 1 — Microbiome intervention:

Arm A: Screened healthy-donor FMT (oral capsules, 30 capsules over 3 days, pre-pembrolizumab)
Arm B: Placebo capsules (autologous stool, processed identically)

Factor 2 — Antibiotic avoidance:

Arm X: Strict antibiotic stewardship protocol (avoid all antibiotics during first 12 weeks; treat infections with narrowest-spectrum agent if absolutely necessary; document all violations)
Arm Y: Standard of care (no antibiotic restrictions)

Four arms: FMT+stewardship (AX), FMT+standard (AY), Placebo+stewardship (BX), Placebo+standard (BY)

Primary endpoint: Objective response rate (ORR) by RECIST v1.1 at 24 weeks. Key secondary: PFS, Shannon diversity change from baseline to week 6, CD8+ TIL density change (paired biopsies at baseline and week 6), circulating T cell clonality (TCRseq).

Confounder control:

Antibiotics: Factor 2 directly tests this. All antibiotic use recorded in real-time diary.
Diet: Standardized dietary guidance (high-fiber, Mediterranean-style) for all arms. Food frequency questionnaire at weeks 0, 6, 12. Diet is a confounder to measure, not a separate intervention (would require 2×2×2 design = 800 patients).
Geography: Stratify randomization by country. Include site as random effect in mixed models.

Biological sampling:

Stool: weeks 0, 2, 6, 12, 24 → shotgun metagenomics + metabolomics
Blood: weeks 0, 6, 12 → CyTOF (immune phenotyping), plasma metabolomics
Tumor: weeks 0, 6 → IHC (CD8, PD-L1, FoxP3) + spatial transcriptomics

Decision criteria:

FMT improves ORR by ≥15% absolute (40→55%): proceed to Phase III
Antibiotic stewardship improves ORR by ≥10%: publish clinical guideline
If FMT shows no benefit but antibiotic stewardship does: the signal is about PRESERVATION of existing diversity, not transplantation of new diversity
If neither works: microbiome manipulation is insufficient, and the microbiome-immunotherapy association is correlative/confounded

Analysis: Primary: logistic regression with FMT and stewardship as main effects + interaction term. Test interaction to determine whether FMT + stewardship is synergistic (maintaining diversity of transplanted microbiome requires avoiding antibiotics). Secondary: mediation analysis with Shannon diversity as mediator between treatment and response.

Verification: llm-judge
Cascade risk: Terminal step.

End of Batch 2 — 20 examples (Chains 11-30) with full data provenance.

Summary of database queries (2026-02-17):

PDB: 6OIM, 3OG7, 4IVA, 5UAK, 7DTD, 4ZQK, 2P4E, 6VXX, 1IEP, 2HYY, 6LZG, 6M0J, 3BPS, 7SI9, 6JQR, 4JA8, 2QRV, 9CZI, 8DCZ
ChEMBL: CHEMBL4535757 (sotorasib), CHEMBL1229517 (vemurafenib), CHEMBL1789941 (ruxolitinib), CHEMBL2010601 (ivacaftor), CHEMBL941 (imatinib), CHEMBL3353410 (osimertinib), CHEMBL4802135 (nirmatrelvir), CHEMBL3301622 (gilteritinib), CHEMBL1171837 (ponatinib)
ClinVar: KRAS (194), BRAF (352), JAK2 (200), CFTR (2,152/6,170), SCN1A (2,858/5,158), PCSK9 (1,322), TP53 (1,705/3,912), BRCA1 (13,966/15,670), BRCA2 (21,248), PTEN (1,922), ABL1 (94), FLT3 (50), DNMT3A (352), IDH1 (35), IDH2 (80), NPM1 (29), APP (131), PSEN1 (196), APC (12,608/16,550), MLH1 (3,698)
Open Targets: NSCLC, melanoma, myelofibrosis, hypercholesterolemia, AML, hepatocellular carcinoma, type 2 diabetes, neoplasm
ClinicalTrials.gov: NCT05398094, NCT04625647, NCT06804824, NCT05371964, NCT05668741, NCT02965326, NCT06598449, NCT03936777, NCT03467113, NCT05193448, NCT03839771, NCT04626024, NCT05999084, NCT06602258, NCT06593563, NCT06643585
UniProt: P01116, P15056, O60674, P13569, P35498, Q8NBP7, P04637, P60484, O75874, P00533, P10721, P36888

Database Query Summary (2026-02-17)

PDB Structures

2SHP, 1M17, 3INM, 1UWH, 6OIM, 3OG7, 4IVA, 5UAK, 7DTD, 4ZQK, 2P4E, 3BPS, 7SI9, 6JQR, 4JA8, 2QRV, 9CZI, 8DCZ, 1IEP, 2HYY

ChEMBL Compounds

Compound	ChEMBL ID	Key Activity
Sotorasib	CHEMBL4535757	KRAS G12C IC50 = 68 nM
Vemurafenib	CHEMBL1229517	BRAF V600E IC50 = 31 nM
Ruxolitinib	CHEMBL1789941	JAK2 IC50 = 3 nM
Ivacaftor	CHEMBL2010601	CFTR potentiator, Phase 4
Imatinib	CHEMBL941	ABL1 IC50 = 40 nM
Nirmatrelvir	CHEMBL4802135	Mpro IC50 = 0.79 nM
Gilteritinib	CHEMBL3301622	FLT3 IC50 = 0.41 nM
Ponatinib	CHEMBL1171837	ABL1 T315I IC50 = 8.6 nM

ClinVar Gene Variants

Gene	Pathogenic	Total	Link
CFTR	2,152	6,170	ClinVar
SCN1A	2,858	5,158	ClinVar
TP53	1,705	3,912	ClinVar
PTEN	1,922	—	ClinVar
PCSK9	1,322	—	ClinVar
BRAF	352	—	ClinVar
DNMT3A	352	—	ClinVar
JAK2	200	—	ClinVar
PINK1	87	—	ClinVar
ABL1	94	—	ClinVar
FLT3	50	—	ClinVar

UniProt Entries

Protein	UniProt ID	Length	Key Domains
KRAS	P01116	189 aa	GTPase
BRAF	P15056	766 aa	RBD, Kinase (457–717)
JAK2	O60674	1,132 aa	FERM, SH2, JH2, JH1
CFTR	P13569	1,480 aa	TMD1, NBD1, TMD2, NBD2
SCN1A	P35498	2,009 aa	Nav1.1 channel
PCSK9	Q8NBP7	692 aa	Peptidase S8
PINK1	Q9BXM7	—	Kinase (156–511)
FLT3	P36888	993 aa	Kinase (610–943)
EGFR	P00533	—	Kinase (712–979)

Generated 2026-02-17. All database queries performed on the same date unless otherwise noted.

FilesExpand file tree

LABBench2Pro_AllExamples.md

Latest commit

History

LABBench2Pro_AllExamples.md

File metadata and controls

LABBench2-Pro: Complete Benchmark Examples (Chains 1–30)

Table of Contents

Database Links Reference

Chain 1: Paper to Experiment (4 steps)

Step 1 — Extract key finding from literature

Step 2 — Quantitative data interpretation

Step 3 — Statistical test selection

Step 4 — Hypothesis generation

Chain 2: Structure to Drug (4 steps)

Step 1 — Identify structural features

Step 2 — Explain binding mechanism

Step 3 — SAR prediction

Step 4 — Experimental validation plan

Chain 3: Stats Pipeline (3 steps)

Step 1 — Choose statistical framework

Step 2 — Multiple testing correction

Step 3 — Pathway interpretation

Chain 4: Critical Appraisal (3 steps)

Step 1 — Evaluate strength of evidence

Step 2 — Integrate contradictory evidence

Step 3 — Design definitive experiment

Chain 5: Genetics to Therapy (3 steps)

Step 1 — Gene function and disease mechanism

Step 2 — Structural consequence of mutation

Step 3 — Therapeutic strategy

Chain 6: Protocol Troubleshoot (3 steps)

Step 1 — Diagnose protocol error

Step 2 — Interpret corrected result

Step 3 — Quantitative follow-up

Chain 7: Paradox Resolution (3 steps)

Step 1 — Explain paradoxical result

Step 2 — Design discriminating experiment

Step 3 — Synthesize conclusion from results

Chain 8: Sequence to Function (3 steps)

Step 1 — Identify protein from sequence

Step 2 — Predict functional consequences of sequence differences

Step 3 — Design validation experiment

Chain 9: Data to Mechanism (3 steps)

Step 1 — Interpret ambiguous data

Step 2 — Update with new evidence

Step 3 — Correct prior analysis

Chain 10: Evidence Synthesis (3 steps)

Step 1 — Compare conflicting papers

Step 2 — Meta-analytic reasoning

Step 3 — Clinical recommendation

Chain 11: Structure to Drug (4 steps)

Step 1 — Identify structural features

Step 2 — Explain binding mechanism

Step 3 — SAR prediction

Step 4 — Experimental validation plan

Chain 12: Paper to Experiment (4 steps)

Step 1 — Extract key finding from literature

Step 2 — Quantitative data interpretation

Step 3 — Statistical test selection

Step 4 — Hypothesis generation

Chain 13: Stats Pipeline (3 steps)

Step 1 — Choose statistical framework

Step 2 — Multiple testing correction

Step 3 — Pathway interpretation

Chain 14: Critical Appraisal (3 steps)

Step 1 — Evaluate strength of evidence

Step 2 — Integrate contradictory evidence

Step 3 — Design definitive experiment

Chain 15: Genetics to Therapy (3 steps)

Step 1 — Gene function and disease mechanism

Step 2 — Structural consequence of mutation

Step 3 — Therapeutic strategy

Chain 16: Protocol Troubleshoot (3 steps)

Step 1 — Diagnose protocol error

Step 2 — Interpret corrected result

Step 3 — Quantitative follow-up

Chain 17: Paradox Resolution (3 steps)

Step 1 — Explain paradoxical result

Step 2 — Design discriminating experiment